DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and Slc31a1

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_598284.1 Gene:Slc31a1 RGDID:620059 Length:187 Species:Rattus norvegicus

Alignment Length:238 Identity:92/239 (38%)
Similarity:120/239 (50%) Gaps:60/239 (25%)


  Fly    11 VDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAHNHGGGSGTGM 75
            ::|...| |:||:|....|   |..|                   |.......:|:|        
  Rat     3 MNHMEMH-HMGMNHTDDNI---TMPP-------------------HQHPTTSASHSH-------- 36

  Fly    76 EHMMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYR 139
            |.||||.|:||: |..:|||...|.|...:.|:.:|:||||:.|||||..||.|..|:...:.|.
  Rat    37 EMMMPMTFYFGFKNVDLLFSSLVINTPGEMAGAFVAVFLLAMFYEGLKIAREGLLRKSQVSIRYN 101

  Fly   140 --PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVV---HKQ-PPSMLSINHLLQTLLHVLQVTLSF 198
              ||.||.                      |.::   ||. ...|||..|||||:||::||.:|:
  Rat   102 SMPVPGPN----------------------GTILMETHKTVGQQMLSFPHLLQTVLHIIQVVISY 144

  Fly   199 LLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH 241
            .|||||||||.:||:.|..||..|||||.|||:|:||:|||||
  Rat   145 FLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH 187

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 66/154 (43%)
Slc31a1NP_598284.1 Ctr 40..172 CDD:282057 66/154 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 1 1.000
Homologene 1 1.000 H1399
Inparanoid 1 1.050 144 1.000 Inparanoid score I4278
OMA 1 1.010
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 1 1.000 T1086048
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 LDO PTHR12483
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
1211.840

Return to query results.
Submit another query.