DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and SLC31A2

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:XP_016869756.1 Gene:SLC31A2 HGNCID:11017 Length:199 Species:Homo sapiens

Alignment Length:151 Identity:49/152 (32%)
Similarity:80/152 (53%) Gaps:14/152 (9%)


  Fly    77 HMMPMAFHFGYNET--ILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLFWKTYNLLEYR 139
            |....:.||.:::|  :||.:|.:.:.||:..|::.:.|||::|||:|..:.       .||...
Human    53 HRNSFSMHFIFSDTAVLLFDFWSVHSPAGMALSVLVLLLLAVLYEGIKVGKA-------KLLNQV 110

  Fly   140 PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVVHKQPPSMLSINHLLQTLLHVLQVTLSFLLMLIF 204
            .|..|....:.....:...:|.|....||...|:     ..:.|..|:|:||:||.:.:.:||..
Human   111 LVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHR-----WYLCHFGQSLIHVIQVVIGYFIMLAV 170

  Fly   205 MTYNVWLCLMVVLGAAVGYFL 225
            |:||.|:.|.||||:||||:|
Human   171 MSYNTWIFLGVVLGSAVGYYL 191

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 48/150 (32%)
SLC31A2XP_016869756.1 Ctr 58..191 CDD:282057 47/145 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C130933
eggNOG 1 0.900 E1_KOG3386
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR12483
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
76.930

Return to query results.
Submit another query.