DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Ctr1A and SLC31A1

Sequence 1:NP_001245552.1 Gene:Ctr1A FlyBaseID:FBgn0062413 Length:241 Species:Drosophila melanogaster
Sequence 2:NP_001850.1 Gene:SLC31A1 HGNCID:11016 Length:190 Species:Homo sapiens

Alignment Length:248 Identity:99/249 (40%)
Similarity:128/249 (51%) Gaps:65/249 (26%)


  Fly     1 MDHAHHSAPGVDHSMHHDHVGMHHDHSGIPAATASPMDAASMFDLIPDTSDLQASHAGHAAHGAH 65
            |||:|             |:||            |.||:         .|.:|.||.......:|
Human     1 MDHSH-------------HMGM------------SYMDS---------NSTMQPSHHHPTTSASH 31

  Fly    66 NHGGGSGTGMEHMMPMAFHFGY-NETILFSWWHIETVAGLIGSMIAIFLLALMYEGLKYYREYLF 129
            :||||..:.|  ||||.|:||: |..:|||...|.|...:.|:.:|:||||:.|||||..||.|.
Human    32 SHGGGDSSMM--MMPMTFYFGFKNVELLFSGLVINTAGEMAGAFVAVFLLAMFYEGLKIARESLL 94

  Fly   130 WKTYNLLEYR--PVTGPQRNPEAPRIPSPAAAAPSPVQYVGEVV---HKQ-PPSMLSINHLLQTL 188
            .|:...:.|.  ||.||.                      |.::   ||. ...|||..|||||:
Human    95 RKSQVSIRYNSMPVPGPN----------------------GTILMETHKTVGQQMLSFPHLLQTV 137

  Fly   189 LHVLQVTLSFLLMLIFMTYNVWLCLMVVLGAAVGYFLFCWKKSVIVDVTEHCH 241
            ||::||.:|:.|||||||||.:||:.|..||..|||||.|||:|:||:|||||
Human   138 LHIIQVVISYFLMLIFMTYNGYLCIAVAAGAGTGYFLFSWKKAVVVDITEHCH 190

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Ctr1ANP_001245552.1 Ctr 79..226 CDD:282057 66/154 (43%)
SLC31A1NP_001850.1 Ctr 45..175 CDD:309321 64/152 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG3386
Hieranoid 1 1.000
Homologene 1 1.000 H1399
Inparanoid 1 1.050 160 1.000 Inparanoid score I4184
Isobase 1 0.950 0 Normalized mean entropy S2329
OMA 1 1.010
OrthoDB 1 1.010 D1389393at2759
OrthoFinder 1 1.000 FOG0000467
OrthoInspector 1 1.000 T1072389
orthoMCL 1 0.900 OOG5_128847
Panther 1 1.100 LDO PTHR12483
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4018
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1413.820

Return to query results.
Submit another query.