DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc7 and AT5G63940

DIOPT Version :9

Sequence 1:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_201199.1 Gene:AT5G63940 / 836515 AraportID:AT5G63940 Length:705 Species:Arabidopsis thaliana


Alignment Length:321 Identity:73/321 - (22%)
Similarity:112/321 - (34%) Gaps:102/321 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 PGSHYRRPKTGVPSTNVVYANGGGSWRAAPRQTQRLPRQTVQQYATGTPATGSAGRHS------G 71
            ||.|:.|.         :|.|...||      |:...::.|.|:.:..     .||||      .
plant   244 PGWHFLRG---------LYGNNRKSW------TKVSAKKAVLQWVSRL-----RGRHSETVIYLD 288

  Fly    72 RAFATAGATEEQTVEFN---------GAAVMGLPATPRTTKQARNKSEEAINDLLTRIPDIGKLF 127
            |..:.:|..|:.:...:         |:.:|..|.:|..   ..|...|.:..|..:.....:||
plant   289 RKRSDSGCDEDCSSSIDGEDVSISRFGSELMQSPLSPFI---GSNNIPEELEGLHEKYSSTCRLF 350

  Fly   128 DV------------HSRIGNGTFSTVLLGTLRRESHLPDSLRRKFAIKHHIPTSHPDRIMK---- 176
            ..            .:.:|.|..|.|..|      .|||.  |:.|:|...|...   ::|    
plant   351 TYEEVLSITSNFASENLVGEGGNSYVYRG------DLPDG--RELAVKILKPCLD---VLKEFIL 404

  Fly   177 ELQCMTKMGGKENVVGI--------HCCMRYDASAAFVMPFMAHDRFQD---------FYTRMDV 224
            |::.:|.:..| |:|.:        :..:.||......:....|...:|         :...:.|
plant   405 EIEVITSVHHK-NIVSLFGFCFENNNLMLVYDYLPRGSLEENLHGNRKDAKKFGWMERYKVAVGV 468

  Fly   225 PEIRQYMRNLLVALRHVHKFDVIHRDVKPSNFLYNRRRREF--LLVDFGLA-------QHV 276
            .|...|:.|       .|..:|||||||.||.|.   ..:|  .|.|||.|       |||
plant   469 AEALDYLHN-------THDPEVIHRDVKSSNVLL---ADDFEPQLSDFGFASLASSTSQHV 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 48/194 (25%)
PKc_like <474..644 CDD:304357
PKc_like <616..675 CDD:304357
AT5G63940NP_201199.1 USP_Like 24..146 CDD:238182
S_TKc 366..631 CDD:214567 46/176 (26%)
PKc_like 368..635 CDD:304357 46/174 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.