DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc7 and CPK16

DIOPT Version :9

Sequence 1:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_179379.1 Gene:CPK16 / 816299 AraportID:AT2G17890 Length:571 Species:Arabidopsis thaliana


Alignment Length:245 Identity:54/245 - (22%)
Similarity:90/245 - (36%) Gaps:41/245 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QTQRLPRQTVQQYATGTPATGSAGRHSGRAFATAGATEEQTVEFNGAAVMGLPATPRTTKQARNK 108
            :||  ||:......|.|..|...|:...:..:..|....:|:.:......|.             
plant    51 RTQ--PRRNATAKKTPTRHTPPHGKVREKVISNNGRRHGETIPYGKRVDFGY------------- 100

  Fly   109 SEEAINDLLTRIPDIGKLFDVHSRIGNGTFSTVLLGTLRRESHLPDSLRRKFAIKHHIPTSHPDR 173
                ..|...|. .||||      :|:|.|....:.|.::..... ::::....|..||.:..| 
plant   101 ----AKDFDHRY-TIGKL------LGHGQFGYTYVATDKKTGDRV-AVKKIDKAKMTIPIAVED- 152

  Fly   174 IMKELQCMTKMGGKENVVGIHCCMRYDASAAFVMPFMAHDRFQD--------FYTRMDVPEIRQY 230
            :.:|::.:..:.|.||||..:.......|...||.........|        .|:..|...:   
plant   153 VKREVKILQALTGHENVVRFYNAFEDKNSVYIVMELCEGGELLDRILARKDSRYSERDAAVV--- 214

  Fly   231 MRNLLVALRHVHKFDVIHRDVKPSNFLYNRRRREFLL--VDFGLAQHVNP 278
            :|.:|......|...::|||:||.|||:.....:..|  .||||:..:.|
plant   215 VRQMLKVAAECHLRGLVHRDMKPENFLFKSTEEDSPLKATDFGLSDFIKP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 39/164 (24%)
PKc_like <474..644 CDD:304357
PKc_like <616..675 CDD:304357
CPK16NP_179379.1 STKc_CAMK 107..367 CDD:270687 42/170 (25%)
S_TKc 108..368 CDD:214567 41/169 (24%)
PTZ00184 404..549 CDD:185504
EFh 415..476 CDD:238008
EFh 496..550 CDD:238008
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.