DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc7 and Pak1

DIOPT Version :9

Sequence 1:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster
Sequence 2:NP_001344291.1 Gene:Pak1 / 18479 MGIID:1339975 Length:552 Species:Mus musculus


Alignment Length:261 Identity:62/261 - (23%)
Similarity:97/261 - (37%) Gaps:47/261 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 ATGTPATGSAGRHSGRAFATAGATEEQTVEFNGAAVMGLPATP---------------------- 99
            ||..|.......|: ::|   |..:::.| :..:.:..||.||                      
Mouse   183 ATPPPVIAPRPEHT-KSF---GQKDQREV-YTRSVIEPLPVTPTRDVATSPISPTENNTTPPDAL 242

  Fly   100 -RTTKQARNK---SEEAINDLLTRIPDIG---KLFDVHSRIGNGTFSTVLLGTLRRESHLPDSLR 157
             |.|::.:.|   |:|.|.:.|..|..:|   |.:....:||.|...||.       :.:..:..
Mouse   243 TRNTEKQKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVY-------TAMDVATG 300

  Fly   158 RKFAIKHHIPTSHPDR--IMKELQCMTKMGGKENVVGIHCCMRYDASAAFVMPFMAHDRFQDFYT 220
            ::.|||.......|.:  |:.|:..| :.....|:|..............||.::|.....|..|
Mouse   301 QEVAIKQMNLQQQPKKELIINEILVM-RENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVT 364

  Fly   221 R--MDVPEIRQYMRNLLVALRHVHKFDVIHRDVKPSNFLYNRRRREFLLVDFGLAQHVNPPAARS 283
            .  ||..:|....|..|.||..:|...|||||:|..|.|.. ......|.|||....:.|..::.
Mouse   365 ETCMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLG-MDGSVKLTDFGFCAQITPEQSKR 428

  Fly   284 S 284
            |
Mouse   429 S 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 42/164 (26%)
PKc_like <474..644 CDD:304357
PKc_like <616..675 CDD:304357
Pak1NP_001344291.1 PBD 74..128 CDD:334253
STKc_PAK1 256..551 CDD:270820 48/183 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.