DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc7 and AgaP_AGAP012148

DIOPT Version :9

Sequence 1:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_320380.4 Gene:AgaP_AGAP012148 / 1280530 VectorBaseID:AGAP012148 Length:184 Species:Anopheles gambiae


Alignment Length:193 Identity:44/193 - (22%)
Similarity:75/193 - (38%) Gaps:58/193 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   471 TPGYRPPEVLLKYPDQTTAVDVWAAGVIFLSIMS--TVYPFFKAPNDFIALAEIVTIFGDQAIRK 533
            |..||.||::|.:......||:|:.|.|...:::  |::|.....:....:.||:....|:.:.|
Mosquito     7 TRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIHQLNLIMEILGTPNDEFMAK 71

  Fly   534 TALALDRMITLSQRSRPLNLRKLCLRFRYRSVFSDAKLLKSYESVDGSCEVCRNCDQYFFNCLCE 598
            .:         |:.:|                    ..:||....:.     ||..         
Mosquito    72 IS---------SESAR--------------------HYIKSLPKTEK-----RNFS--------- 93

  Fly   599 DSDYLTEPLDAYECFPPSAYDLLDRLLEINPHKRITAEEALKHPFF----TAAEEAEQTEQDQ 657
                     |.:....|.|.|||:::||::..||||||:||.||:.    ..::|...:..||
Mosquito    94 ---------DVFRGANPLAIDLLEKMLELDADKRITAEQALAHPYLEKYADPSDEPTSSLYDQ 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 41/174 (24%)
PKc_like <474..644 CDD:304357 40/171 (23%)
PKc_like <616..675 CDD:304357 19/46 (41%)
AgaP_AGAP012148XP_320380.4 PKc_like <1..172 CDD:304357 44/193 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.