DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc7 and AgaP_AGAP013439

DIOPT Version :9

Sequence 1:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_003436354.1 Gene:AgaP_AGAP013439 / 11176106 VectorBaseID:AGAP013439 Length:289 Species:Anopheles gambiae


Alignment Length:125 Identity:26/125 - (20%)
Similarity:57/125 - (45%) Gaps:9/125 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly   156 LRRKFAI----KHHIPTSHPDRIMKELQCMTKMGGKENVVGIHCCMRYDASAAFVMPFMAHDRFQ 216
            ||.:.||    |..:...:..::.:|::.|.:: ...:|:.::..|...:....|..:.:.....
Mosquito     8 LRFQVAIKIIDKSQLDPGNLQKVYREVEIMKRL-DHPHVIKLYQVMETQSMIYIVSEYASQGEIF 71

  Fly   217 DF---YTRMDVPEIRQYMRNLLVALRHVHKFDVIHRDVKPSNFLYNRRRREFLLVDFGLA 273
            |:   |.|::....|.....:|.|:.:.|...::|||:|..|.|.: .:.:..:.|||.:
Mosquito    72 DYIAKYGRLNERAARNKFWQILSAVEYCHNKGIVHRDLKAENLLLD-SKMDIKIADFGFS 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 26/125 (21%)
PKc_like <474..644 CDD:304357
PKc_like <616..675 CDD:304357
AgaP_AGAP013439XP_003436354.1 PKc_like 11..237 CDD:304357 24/122 (20%)
S_TKc 11..237 CDD:214567 24/122 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.