DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc7 and dmpk

DIOPT Version :9

Sequence 1:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_009303323.1 Gene:dmpk / 101886625 -ID:- Length:600 Species:Danio rerio


Alignment Length:181 Identity:40/181 - (22%)
Similarity:66/181 - (36%) Gaps:60/181 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   100 RTTKQARNKSEEAINDLLTRIPDIGKLFDVHSRIGNGTFSTVLLGTLRRESHLPDSLRRKFAIKH 164
            |..|:.|...|:               |.:...||.||||.|.|..:|       :.::.:|:| 
Zfish    67 RQVKKTRISRED---------------FHILKVIGRGTFSEVALARMR-------NTQQVYAVK- 108

  Fly   165 HIPTSHPDRIMK--------ELQCMTK------MGGKENVVGIHCCMRYDASAAFVMPFMAH--- 212
                     ||.        |:.|..:      .|.:..:..:|...:.|.....||.:...   
Zfish   109 ---------IMNKWDMLKRGEMACYQEEREVLLKGDRRWITELHYAFQDDDYLYLVMHYYVGGDL 164

  Fly   213 ----DRFQDFYTRMDVPE--IRQYMRNLLVALRHVHKFDVIHRDVKPSNFL 257
                .:|.|     .:||  .:.|:..:::|:..||....:|||:||.|.|
Zfish   165 LTLLSKFND-----GLPEEMAQFYLAEMVMAIDSVHLLGYVHRDIKPDNIL 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 36/156 (23%)
PKc_like <474..644 CDD:304357
PKc_like <616..675 CDD:304357
dmpkXP_009303323.1 PKc_like 77..406 CDD:304357 37/171 (22%)
S_TKc 79..344 CDD:214567 36/154 (23%)
bZIP <482..513 CDD:304365
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.