DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cdc7 and speg

DIOPT Version :9

Sequence 1:NP_727103.1 Gene:Cdc7 / 31598 FlyBaseID:FBgn0028360 Length:700 Species:Drosophila melanogaster
Sequence 2:XP_031748703.1 Gene:speg / 100486621 XenbaseID:XB-GENE-984260 Length:3808 Species:Xenopus tropicalis


Alignment Length:534 Identity:88/534 - (16%)
Similarity:157/534 - (29%) Gaps:194/534 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 TKQARNKSEE------------------AINDL-LTRIPDIGKLFDVHSRIGNGTFSTVLLGTLR 147
            |..|||.|.|                  ||.:: :.::..:...:::|..||.|.||.|      
 Frog  1598 TCTARNLSGEISCKAELQVCPDEPGAGSAIQEIDILKVRRLTDFYNIHKEIGRGAFSYV------ 1656

  Fly   148 RESHLPDSLRRKFAIKHHIPTSHPDR--IMKELQCMTKMGGKENVVGIHCCMRYDASAAFVMPFM 210
              .|:.:....:......||.....|  ..:|...::|: ..:.::..:......::...||...
 Frog  1657 --RHVVEKSNGRDLAAKFIPFRGATRESARRERDILSKL-RHDRIIFFYDAFEKRSALIIVMELC 1718

  Fly   211 AHDRFQDFYTR---MDVPEIRQYMRNLLVALRHVHKFDVIHRDVKPSNFLY-NRRRREFLLVDFG 271
            :.:...:..||   :...|||.::|.:|..|.::|..:::|.|:||.|.|. :....:..:.|||
 Frog  1719 SQEELLERLTRKPTVSESEIRSFIRQILEGLDYLHHKNILHLDIKPENILMADTTSEQIRICDFG 1783

  Fly   272 LAQHVNP--PAARSSGSAAAIA--------------------------------AANNKNNNNNN 302
            .||.:.|  |.....|:...:|                                ...|......|
 Frog  1784 NAQELTPGDPQYCKYGTPEFVAPEIVNQMPISTVTDIWPVGVLAYLCLTGVSPFVGENDYTTLMN 1848

  Fly   303 ----------------------------NNNSKRPRERESKGDVQQIALDAGLGGAVKRMRLHEE 339
                                        .|...||...||........|..|...:...::|.:.
 Frog  1849 IRGYTVAFEEKMFVGLTREARGFLIKVLGNEKLRPNAEESLEHPWFKTLAKGKSISTDHLKLFQS 1913

  Fly   340 SNKMPLKPV---NDIAPSDAPEQSVDGSNHV------------------------------QPQL 371
            ..|.....:   :::.....||...|.|||:                              .|..
 Frog  1914 RRKWQRSLISYKSNMVMRTIPELLQDTSNHLSIAVPKNSKEASGLSSSSDSDDLEELPFVPMPLQ 1978

  Fly   372 VQ-------------QEQQQLQPQQQ--------------------QQQQQQQQQSQQQQQP--- 400
            ||             .|:|..|||..                    ::|..||:::..|..|   
 Frog  1979 VQFSGSRMSLNEIPTDEEQLSQPQDNGSCREDEEEGSQAVEISSTFKEQAVQQKEATVQASPLSK 2043

  Fly   401 ----------------------QQQSQQQHPQRQPQLAQMDQTASTPSGSKYNTNRNVSAAAANN 443
                                  .:..:::||:|..:.....::|..|.|       .:.||....
 Frog  2044 HAKGTLTRNRSAEVGSSSDEETSETEKREHPRRPLKKGSSLESADVPDG-------EIKAARRGE 2101

  Fly   444 AKCVCFANPSVCLN 457
            .:....|:.::.||
 Frog  2102 LRRGSSADSALLLN 2115

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cdc7NP_727103.1 STKc_Cdc7 125..644 CDD:270921 80/492 (16%)
PKc_like <474..644 CDD:304357
PKc_like <616..675 CDD:304357
spegXP_031748703.1 Ig strand A 910..912 CDD:409353
Ig strand A' 915..920 CDD:409353
Ig strand B 925..934 CDD:409353
Ig strand C 940..945 CDD:409353
Ig strand C' 948..950 CDD:409353
Ig strand D 956..961 CDD:409353
Ig strand E 965..971 CDD:409353
Ig strand F 979..987 CDD:409353
Ig strand G 990..1000 CDD:409353
Ig 1014..1099 CDD:416386
Ig strand A' 1017..1020 CDD:409353
Ig strand B 1024..1033 CDD:409353
Ig strand C 1038..1047 CDD:409353
Ig strand C' 1050..1052 CDD:409353
Ig strand D 1058..1063 CDD:409353
Ig strand F 1079..1086 CDD:409353
Ig strand G 1089..1099 CDD:409353
Ig 1105..1194 CDD:416386
Ig strand A 1105..1108 CDD:409353
Ig strand A' 1111..1116 CDD:409353
Ig strand B 1121..1128 CDD:409353
Ig strand C 1135..1141 CDD:409353
Ig strand C' 1142..1145 CDD:409353
Ig strand D 1150..1156 CDD:409353
Ig strand E 1159..1169 CDD:409353
Ig strand F 1173..1181 CDD:409353
Ig strand G 1183..1194 CDD:409353
I-set 1231..1320 CDD:400151
Ig strand A 1231..1234 CDD:409353
Ig strand A' 1237..1242 CDD:409353
Ig strand B 1247..1254 CDD:409353
Ig strand C 1261..1267 CDD:409353
Ig strand C' 1268..1271 CDD:409353
Ig strand D 1276..1282 CDD:409353
Ig strand E 1285..1295 CDD:409353
Ig strand F 1299..1307 CDD:409353
Ig strand G 1309..1320 CDD:409353
I-set 1527..1616 CDD:400151 6/17 (35%)
Ig strand A' 1535..1538 CDD:409353
Ig strand B 1542..1551 CDD:409353
Ig strand C 1556..1562 CDD:409353
Ig strand C' 1565..1567 CDD:409353
Ig strand D 1573..1578 CDD:409353
Ig strand E 1580..1588 CDD:409353
Ig strand F 1596..1603 CDD:409353 2/4 (50%)
Ig strand G 1606..1616 CDD:409353 1/9 (11%)
PKc_like 1639..1894 CDD:419665 46/263 (17%)
I-set 2923..3013 CDD:400151
Ig strand A 2923..2926 CDD:409353
Ig strand A' 2929..2934 CDD:409353
Ig strand B 2939..2946 CDD:409353
Ig strand C 2953..2959 CDD:409353
Ig strand C' 2960..2963 CDD:409353
Ig strand D 2969..2975 CDD:409353
Ig strand E 2978..2988 CDD:409353
Ig strand F 2992..3000 CDD:409353
PHA03247 <3106..3499 CDD:223021
PKc_like 3496..3752 CDD:419665
I-set 50..132 CDD:400151
Ig strand A 50..52 CDD:409353
Ig strand A' 54..60 CDD:409353
Ig strand B 67..74 CDD:409353
Ig strand C 80..85 CDD:409353
Ig strand C' 87..90 CDD:409353
Ig strand F 111..119 CDD:409353
Ig strand A 764..767 CDD:409353
I-set 765..854 CDD:400151
Ig strand A' 770..774 CDD:409353
Ig strand B 782..790 CDD:409353
Ig strand C 795..800 CDD:409353
Ig strand C' 803..805 CDD:409353
Ig strand D 811..816 CDD:409353
Ig strand E 819..824 CDD:409353
Ig strand F 833..841 CDD:409353
Ig strand G 844..854 CDD:409353
Ig 910..1000 CDD:416386
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.