DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pat1 and Nphp3

DIOPT Version :8

Sequence 1:NP_001259286.1 Gene:Pat1 / 31593 FlyBaseID:FBgn0029878 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_082997.3 Gene:Nphp3 / 74025 MGIID:1921275 Length:1325 Species:Mus musculus

Alignment Length:589 Identity:127/590 (22%)
Similarity:215/590 (36%) Gaps:138/590 (23%)


  Fly   114 ENYVSRYEVVAGHEEEELESSMDTVEDRSTEFSSLYTYDSESTNADSISDFNDEFS-ADIGSIVG 177
            ::.||.|::|..|..|.:.|..|  ::..|:...|........:...:.:...|.| ..:.|||.
Mouse   738 QDTVSLYKLVLHHVRESMPSDRD--KEWMTQILCLINVSHNGVSESELMELYPEMSWLSLTSIVH 800

  Fly   178 LPHR-RATQEELDAINDSGLEELSAVELQVIDLGLRLGS--------FLSEAGWMQESITVLACL 233
            ..|: .........:....|:....|.||.::....:.|        |.|:..  |:.:|..:. 
Mouse   801 SLHKMHLLTYSCGLLRFQHLQAWETVRLQYLEDPALVSSYREKLISYFASQLS--QDRVTWRSA- 862

  Fly   234 NVRLKDLPTHKHWL-------QFRLDCLQRLLYAESAHCNFKEAEKTYAELMGLNKWLNKSVPNQ 291
                .:||    ||       |....||..||.|::.   :|...  :|||  |:.|       |
Mouse   863 ----DELP----WLFQQQGSKQKLHSCLLNLLVAQNL---YKRGH--FAEL--LSYW-------Q 905

  Fly   292 LVAITYSQISAMYF-ARNEYKNSHLWSGLAMRFLKGYANPRTIIDVLRQAAKACVVKRDFARANL 355
            .|......::..|| :..:|:||           :|..|...:.|:.....:       |.:...
Mouse   906 FVGKDKGAMATEYFESLKQYENS-----------EGEENMLCLADLYETLGR-------FLKDLG 952

  Fly   356 LICQAV---RRAREY----FGPTHQKYGDALLDYGFFLLNVDSVFQSVNIYKEALAVRRGIFGNM 413
            |:.|||   :|:.|.    ..|.|.:...:|.......:.......:..:||:||.:....:|..
Mouse   953 LLSQAVVPLQRSLEIRETALDPDHPRVAQSLHQLAGVYVQWKKFGDAEQLYKQALEISENAYGAD 1017

  Fly   414 NFHVAIAHEDLSYAYYVHEYSTGDFSCAQDHVDKAVNIMQHLVPSNHLMLASAKRVKALLLEEIA 478
            :.|.|...|.|:..|:           .|:..::|    :|....:.::...|.|.|..|.....
Mouse  1018 HPHAARELEALATLYH-----------KQNKYEQA----EHFRKKSVIIRQQATRRKGSLYGFAL 1067

  Fly   479 LDKMADGIDEEDLLLQSEELHNFALLLSLQVFGEVNVQTAKHYGNLGRLYQTMNRFEEAERMHKK 543
            |.:.|         ||.|||          ..|:...:.|:....||.||...|..|.||:..|:
Mouse  1068 LRRRA---------LQLEEL----------TLGKDKPENARTLNELGVLYFLQNNLETAEQFLKR 1113

  Fly   544 AIKIKSELLGHFDYEVGLSIGHLASLYNYQMKKYRDAEQLYMRSIDISLRLFGNSYSGLEYDYLG 608
            :::::..:||....:...|:.:||:|.| :.|:|..||:||.|::||..|.....:..|.|....
Mouse  1114 SLEMRERVLGPDHPDCAQSLNNLAALCN-EKKQYEKAEELYERALDIRRRALAPDHPSLAYTVKH 1177

  Fly   609 LCHVYETLHNFEKYLKYAHKLENWQMLRGQNLTQNKSSYPAIEVDYSIEEVKAKYFSMCASKKSA 673
            |..:|:.....:|                        :.|..|:   ..|::.|.|.      ..
Mouse  1178 LAILYKKTGKVDK------------------------AVPLYEL---AVEIRQKSFG------PK 1209

  Fly   674 HPSV 677
            ||||
Mouse  1210 HPSV 1213

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pat1NP_001259286.1 DnaQ_like_exo <53..110 CDD:299142
TPR_12 478..547 CDD:290160 18/69 (26%)
TPR_12 516..590 CDD:290160 25/74 (34%)
TPR_10 517..553 CDD:290111 11/36 (31%)
TPR repeat 518..546 CDD:276809 10/28 (36%)
TPR repeat 559..590 CDD:276809 13/31 (42%)
TPR repeat 603..628 CDD:276809 4/25 (16%)
Nphp3NP_082997.3 Kinesin-relat_1 76..145 CDD:289481
Uso1_p115_C 113..199 CDD:282695
OmpH <120..>202 CDD:281871
TPR 1 467..500
P-loop_NTPase 502..>570 CDD:304359
TPR 2 881..914 13/47 (28%)
TPR 3 916..937 7/32 (22%)
TPR_12 937..1012 CDD:290160 15/82 (18%)
TPR_10 937..978 CDD:290111 10/48 (21%)
TPR 4 938..971 8/40 (20%)
TPR repeat 938..966 CDD:276809 7/35 (20%)
TPR_12 976..1054 CDD:290160 15/93 (16%)
TPR repeat 976..1009 CDD:276809 6/33 (18%)
TPR_10 979..1020 CDD:290111 6/41 (15%)
TPR 5 980..1013 5/33 (15%)
TPR repeat 1022..1074 CDD:276809 14/76 (18%)
TPR 6 1022..1055 7/48 (15%)
TPR_12 1085..1162 CDD:290160 26/78 (33%)
TPR_10 1088..1128 CDD:290111 12/40 (30%)
TPR 7 1088..1121 10/33 (30%)
TPR repeat 1088..1116 CDD:276809 10/28 (36%)
TPR_12 1126..1204 CDD:290160 23/106 (22%)
TPR_10 1130..1169 CDD:290111 15/40 (38%)
TPR 8 1130..1163 15/34 (44%)
TPR repeat 1130..1158 CDD:276809 12/29 (41%)
TPR_12 1168..1246 CDD:290160 14/80 (18%)
TPR repeat 1168..1201 CDD:276809 8/60 (13%)
TPR 9 1172..1205 8/60 (13%)
TPR_10 1177..1211 CDD:290111 9/67 (13%)
TPR_12 1210..1288 CDD:290160 4/5 (80%)
TPR_10 1213..1254 CDD:290111 1/2 (50%)
TPR 10 1214..1247 127/590 (22%)
TPR repeat 1214..1242 CDD:276809 127/590 (22%)
TPR 11 1256..1289
TPR repeat 1256..1284 CDD:276809
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.