DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Pat1 and klc3

DIOPT Version :8

Sequence 1:NP_001259286.1 Gene:Pat1 / 31593 FlyBaseID:FBgn0029878 Length:686 Species:Drosophila melanogaster
Sequence 2:NP_001070646.1 Gene:klc3 / 569394 ZFINID:ZDB-GENE-060929-772 Length:512 Species:Danio rerio

Alignment Length:528 Identity:113/529 (21%)
Similarity:192/529 (36%) Gaps:148/529 (28%)


  Fly   101 LMASQKMLAKRLSENYVSRYEVVAGHEEEELESSMDTVEDRSTEFSSLYTYDSESTNADSISDFN 165
            :::.:::|..  ::..::..|.:.|.....|:|..:|::.:::..|||   :.|.|         
Zfish     1 MLSGEEILCS--TQQVIAGLEALRGENRTLLDSLQETLQSQTSSESSL---EQEKT--------- 51

  Fly   166 DEFSADIGSIVGLPHRRATQEELDAINDSGLEELSAVELQV-IDLGLRLGSFLSEAGWMQESITV 229
                    ||:        .|.|:.|      ||...|.|| :.|...|||..:|   .|:    
Zfish    52 --------SII--------LESLERI------ELGLGEAQVMMALSAHLGSLEAE---KQK---- 87

  Fly   230 LACLNVRLKDLPTHKHWLQFRLDCLQR----------LLYAESAHCNFKEAEKTY----AELMGL 280
               |..:::.|.....||:..|...|:          .|..::.|..|..:.:.|    ..|...
Zfish    88 ---LRAQVRRLCQENQWLRDELSRAQQQLQEREQEVVTLEEQNRHLQFMSSIRKYDHEETSLEDK 149

  Fly   281 NKWLNKSVPNQLVAITYSQISAMYFARNEYKNSHL----WSGLAMRFLKGYANP---RTIIDVLR 338
            :....|...:.|            |...|.:.:|:    .|..|.....||..|   ||:.:::.
Zfish   150 DSTSGKESLDDL------------FPTEEEEQTHMSQPHSSAAAAAQQGGYEIPARLRTLHNLVI 202

  Fly   339 QAAKACVVKRDFARANLLICQAVRRAREYFGPTHQKYGDALLDYGFFLLNVDS-VFQSVNIYKEA 402
            |.|.    :..:..|..|..||:....:..|.:|.....        :||:.: |::..|.||||
Zfish   203 QYAS----QGRYEVAVPLCKQALEDLEKSSGHSHPDVAT--------MLNILALVYRDQNKYKEA 255

  Fly   403 LAVRRGIFGNMNFHVAIAHEDLSYAYYVHEYSTGDFSCAQDHVDKAVNIMQHLVPSNHLMLASAK 467
            .::       :|..:||..:.|                ..||...|..:       |:|.:...|
Zfish   256 ASL-------LNDALAIREKTL----------------GMDHPAVAATL-------NNLAVLYGK 290

  Fly   468 RVKALLLEEIALDKMADGIDEEDLLLQSEELHNFALLLSLQVFGEVNVQTAKHYGNLGRLYQTMN 532
            |.|                     ..::|.|...||.:..:|.|..:...||...||..|.|...
Zfish   291 RGK---------------------YKEAEPLCKRALEIREKVLGTDHPDVAKQLNNLALLCQNQG 334

  Fly   533 RFEEAERMHKKAIKIKSELLGHFDYEVGLSIGHLASLYNYQMKKYRDAEQLYMRSIDISLRLFGN 597
            :::|.|:.:::|:.|....||..|..|..:..:|||.| .:..|||.||.||.   :|..|....
Zfish   335 KYQEVEQYYERALHIYQSQLGPDDANVAKTKNNLASCY-LKQGKYRQAEALYK---EILTRAHEK 395

  Fly   598 SYSGLEYD 605
            .:..:|.|
Zfish   396 EFGSVEGD 403

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Pat1NP_001259286.1 DnaQ_like_exo <53..110 CDD:299142 1/9 (11%)
TPR_12 478..547 CDD:290160 15/69 (22%)
TPR_12 516..590 CDD:290160 25/74 (34%)
TPR_10 517..553 CDD:290111 11/36 (31%)
TPR repeat 518..546 CDD:276809 9/28 (32%)
TPR repeat 559..590 CDD:276809 12/31 (39%)
TPR repeat 603..628 CDD:276809 2/4 (50%)
klc3NP_001070646.1 TPR_12 191..268 CDD:290160 22/96 (23%)
TPR_10 194..234 CDD:290111 10/44 (23%)
TPR repeat 195..222 CDD:276809 8/31 (26%)
TPR_12 232..310 CDD:290160 25/137 (18%)
TPR_10 235..275 CDD:290111 14/71 (20%)
TPR repeat 236..264 CDD:276809 9/43 (21%)
TPR_12 274..352 CDD:290160 23/106 (22%)
TPR_10 277..318 CDD:290111 12/69 (17%)
TPR repeat 278..306 CDD:276809 10/56 (18%)
TPR_12 316..394 CDD:290160 27/82 (33%)
TPR_10 319..357 CDD:290111 12/38 (32%)
TPR repeat 319..349 CDD:276809 9/30 (30%)
TPR_1 362..394 CDD:278916 13/36 (36%)
TPR repeat 362..389 CDD:276809 12/31 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E2759_KOG1840
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.