DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and AT5G38070

DIOPT Version :10

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_198623.1 Gene:AT5G38070 / 833787 AraportID:AT5G38070 Length:259 Species:Arabidopsis thaliana


Alignment Length:130 Identity:29/130 - (22%)
Similarity:45/130 - (34%) Gaps:42/130 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LSEAAALRLINGLESAGNATMPLGAQPPQSAAAEAICSSQIVASAHGTPTASTAALEISSARQRM 72
            ||..:.|..:|..:...::....|.....||.|: :|.|:.|                       
plant    12 LSSDSGLGTVNRADPKADSVNEDGVSESISAGAD-LCESKFV----------------------- 52

  Fly    73 LRSHLQESLHSANESGNSCRICRWNRNDMEIIKCPCNCKGSVGYIHLKCLKRWIMHRRDNRCEIC 137
                             .||||.....|.. :..||:|.|::.:.|..|::||...:.|..||||
plant    53 -----------------QCRICHDEDEDTN-MDTPCSCSGTLKFAHHNCVQRWCNEKGDTVCEIC 99

  Fly   138  137
            plant   100  99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 18/47 (38%)
AT5G38070NP_198623.1 RINGv 53..100 CDD:128983 18/48 (38%)
DUF3675 105..216 CDD:463576
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.