DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and M110.3

DIOPT Version :10

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_495728.1 Gene:M110.3 / 187472 WormBaseID:WBGene00010913 Length:189 Species:Caenorhabditis elegans


Alignment Length:65 Identity:18/65 - (27%)
Similarity:27/65 - (41%) Gaps:16/65 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 ALEISSARQRMLRSHLQESLHSANESGNSCRICRWNRNDMEI-IKCPCNCKGSVGYIHLKCLKRW 125
            ||||....|               |:...|:.|....:|..: ...||.|:||:.::|.:||..|
 Worm     2 ALEIDGNEQ---------------ETEKYCKFCFGTESDNALSFVHPCRCRGSIHWVHHQCLAMW 51

  Fly   126  125
             Worm    52  51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 12/36 (33%)
M110.3NP_495728.1 RING_Ubox 14..70 CDD:473075 12/38 (32%)

Return to query results.
Submit another query.