DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17717 and marc-5

DIOPT Version :10

Sequence 1:NP_572327.1 Gene:CG17717 / 31592 FlyBaseID:FBgn0029877 Length:266 Species:Drosophila melanogaster
Sequence 2:NP_496624.3 Gene:marc-5 / 174876 WormBaseID:WBGene00013273 Length:601 Species:Caenorhabditis elegans


Alignment Length:79 Identity:28/79 - (35%)
Similarity:40/79 - (50%) Gaps:11/79 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 QRMLRSHLQESLHSANESGNS----CRICR--WNRNDMEIIKCPCNCKGSVGYIHLKCLKRW--I 126
            |:.|.|....|::|...|..|    ||||.  |..:..:.:..||.|.||:.|:|:.||..|  |
 Worm   300 QKELPSPSASSVYSLARSDMSNEPLCRICHCCWPPDSNDPLISPCRCSGSLQYVHVSCLMHWLDI 364

  Fly   127 MHRRDNR---CEIC 137
            ..|:.:|   ||:|
 Worm   365 SSRKLHRPAICELC 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17717NP_572327.1 RINGv 91..138 CDD:128983 21/54 (39%)
marc-5NP_496624.3 RING_CH-C4HC3_MARCH 325..378 CDD:438158 20/52 (38%)

Return to query results.
Submit another query.