DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ND-B16.6 and Ndufa13

DIOPT Version :8

Sequence 1:NP_001284943.1 Gene:ND-B16.6 / 31578 FlyBaseID:FBgn0029868 Length:154 Species:Drosophila melanogaster
Sequence 2:NP_001264151.1 Gene:Ndufa13 / 100911483 RGDID:6492821 Length:144 Species:Rattus norvegicus

Alignment Length:136 Identity:47/137 (34%)
Similarity:71/137 (52%) Gaps:27/137 (20%)


  Fly    11 KQDLPPPGGYKKIPFARVPPKSYFTGFTTIGTYVVVTAVGLGIYYLTAKKVKR----------DE 65
            |||:||||||..|.:.|..|:...:|::       :.|:|:|.......::.|          ::
  Rat     7 KQDMPPPGGYGPIDYKRNLPRRGLSGYS-------MFALGIGALIFGYWRIMRWNRERRRLLIED 64

  Fly    66 IEMRSAQNVIFPILVAERDREFLRQLRRNRDEEAELMKNVPGWEVGTWYGEPVFKTLPEDTLVTP 130
            :|.|.|   :.|:|.||:||..|:.||.|.:|||.:||:||.|:|    ||.:|.|   ...|.|
  Rat    65 LEARIA---LMPLLQAEKDRRTLQILRENLEEEAIIMKDVPNWKV----GESMFHT---TRWVPP 119

  Fly   131 IFKEFY 136
            :..|.|
  Rat   120 LIGELY 125

Known Domains:


GeneSequenceDomainRegion External IDIdentity
ND-B16.6NP_001284943.1 GRIM-19 9..140 CDD:283794 47/137 (34%)
Ndufa13NP_001264151.1 GRIM-19 5..128 CDD:283794 47/137 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C219633611
eggNOG 1 0.900 E1_KOG3300
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0006011
OrthoInspector 1 1.000 T619259
orthoMCL 1 0.900 OOG5_129943
Panther 1 1.100 LDO PTHR12966
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.710

Return to query results.
Submit another query.