DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mldr and coa-6

DIOPT Version :10

Sequence 1:NP_572309.2 Gene:mldr / 31568 FlyBaseID:FBgn0029858 Length:544 Species:Drosophila melanogaster
Sequence 2:NP_001366833.1 Gene:coa-6 / 172906 WormBaseID:WBGene00013893 Length:471 Species:Caenorhabditis elegans


Alignment Length:84 Identity:19/84 - (22%)
Similarity:31/84 - (36%) Gaps:24/84 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   515 FESNALDEVIPKTLDTFKTVAKMVFIDLPYYVTIDYPAKLMARSLIYRKNLEEKLAVNFKTVNRQ 579
            |.|..|::::|.:.:          .|:|:...:||       .||   ::.|...|:..|.|..
 Worm    65 FTSKKLEDIVPSSHN----------CDVPHVNRVDY-------QLI---DISEDGFVSLLTDNGS 109

  Fly   580 LSDQ----TDRLLNANCSN 594
            ..|.    ||..|.....|
 Worm   110 TKDDLKLPTDEALLTQLKN 128

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mldrNP_572309.2 PRORP 288..525 CDD:465320 3/9 (33%)
coa-6NP_001366833.1 Ribosomal_L7_L12 <227..294 CDD:481186
PRORP 286..>411 CDD:465320
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.