DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rpt4 and AT1G45000

Sequence 1:NP_572308.3 Gene:Rpt4 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_175120.1 Gene:AT1G45000 AraportID:AT1G45000 Length:399 Species:Arabidopsis thaliana

Alignment Length:382 Identity:304/383 (79%)
Similarity:345/383 (90%) Gaps:0/383 (0%)


  Fly    13 RVKALSEYRKKLLEHKEIEGRLKEKREEIKDLTKLYDKSENDLKALQSVGQIVGEVLKQLTEDKF 77
            |..|:::||||||.|||:|.|::..||.::...|.::|:|:|||:|||||||:||||:.|..::.
plant    11 RTAAVTDYRKKLLHHKELESRVRTARENLRAAKKEFNKTEDDLKSLQSVGQIIGEVLRPLDNERL 75

  Fly    78 IVKATNGPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGDVTYSA 142
            ||||::|||||||||.::||.||.|||||.||||||||||.|||||||:||||.|||||:::|||
plant    76 IVKASSGPRYVVGCRSKVDKEKLTSGTRVVLDMTTLTIMRALPREVDPVVYNMLHEDPGNISYSA 140

  Fly   143 IGGLTDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLDANFLKVV 207
            :|||.||||||||.|||||:||||||||||.||||.||||||||||||||||:||.:||||||||
plant   141 VGGLGDQIRELRESIELPLMNPELFLRVGIKPPKGVLLYGPPGTGKTLLARAIASNIDANFLKVV 205

  Fly   208 SSAIVDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQM 272
            ||||:|||||||||||||||||||:|||||||||||||||||||||||||||||||||||||||:
plant   206 SSAIIDKYIGESARLIREMFNYAREHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQL 270

  Fly   273 DGFDSLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKHGEIDYE 337
            ||||.||:|||||||||||.|||||||||||||||||||||||:|:|||||||..||||||||||
plant   271 DGFDQLGKVKMIMATNRPDVLDPALLRPGRLDRKIEIPLPNEQSRMEILKIHASGIAKHGEIDYE 335

  Fly   338 AIVKLSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKVSDNKKLESKLDY 394
            |||||.:.||||||||:|||||:|||||||:|||.|||||||||:|:.|||||...|
plant   336 AIVKLGEGFNGADLRNICTEAGMFAIRAERDYVIHEDFMKAVRKLSEAKKLESSSHY 392

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 304/383 (79%)
AAA 179..311 CDD:278434 123/132 (93%)
AT1G45000NP_175120.1 RPT1 17..390 CDD:224143 301/373 (81%)
AAA 176..309 CDD:278434 123/133 (92%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H100630
Inparanoid 1 1.050 621 1.000 Inparanoid score I201
OMA 1 1.010
OrthoDB 1 1.010 D571919at2759
OrthoInspector 1 1.000 T32260
orthoMCL 1 0.900 OOG5_127828
Panther 1 1.100 O PTHR23073
Phylome 00.000 Not matched by this tool.
88.070

Return to query results.
Submit another query.