DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Rpt4 and Rpt6R

Sequence 1:NP_572308.3 Gene:Rpt4 FlyBaseID:FBgn0028685 Length:397 Species:Drosophila melanogaster
Sequence 2:NP_651811.1 Gene:Rpt6R FlyBaseID:FBgn0039788 Length:399 Species:Drosophila melanogaster

Alignment Length:373 Identity:180/374 (48%)
Similarity:248/374 (66%) Gaps:13/374 (3%)


  Fly    17 LSEYRKKLLEHKEIEGRLKEKREEIKDLTKLYDKSENDLKALQSVGQIVGEVLKQLTEDKFIVKA 81
            ::|.:|.||       ||:.:|.|:....:|.   ..:|:.||..|..:.||:|.:.::|.:||.
  Fly    29 VNERQKNLL-------RLQAQRNELNLKVRLL---REELQLLQEQGSYIAEVVKPMDKNKVLVKV 83

  Fly    82 TNGPRYVVGCRRQLDKAKLKSGTRVALDMTTLTIMRYLPREVDPLVYNMSHEDPGDVTYSAIGGL 146
            ....:|||...:.::...:...:||||...:.|:.:.||.:|||||..|..|...|.||..:|||
  Fly    84 HPEGKYVVDVDKTINIKDVTPSSRVALRNESYTLHKILPNKVDPLVSLMLVEKVPDSTYEMVGGL 148

  Fly   147 TDQIRELREVIELPLLNPELFLRVGITPPKGCLLYGPPGTGKTLLARAVASQLDANFLKVVSSAI 211
            ..||:|::||||||:.:||||..:|||.|||.||||||||||||||||||...:..|::|..|.:
  Fly   149 DKQIQEIKEVIELPVKHPELFDALGITQPKGVLLYGPPGTGKTLLARAVAHHTECTFIRVSGSEL 213

  Fly   212 VDKYIGESARLIREMFNYARDHQPCIIFMDEIDAIGGRRFSEGTSADREIQRTLMELLNQMDGFD 276
            |.|:|||.:|::||:|..||:|.|.||||||||:||..|...|| .|.|:|||::|||||:|||:
  Fly   214 VQKFIGEGSRMVRELFVMAREHAPSIIFMDEIDSIGSARLETGT-GDSEVQRTMLELLNQLDGFE 277

  Fly   277 SLGQVKMIMATNRPDTLDPALLRPGRLDRKIEIPLPNEQARLEILKIHALKIAKHGEIDYEAIVK 341
            :...:|:||||||.|.||.|||||||:|||||.|.|||:|||:|||||:.|:.....|:...|.:
  Fly   278 ATKNIKVIMATNRIDVLDQALLRPGRIDRKIEFPPPNEEARLDILKIHSRKMNLTRGINLRKIAE 342

  Fly   342 LSDNFNGADLRNVCTEAGLFAIRAEREYVIQEDFMKAVRKV--SDNKK 387
            .....:||:::.||||||::|:|..|.:|.||||..||.||  .|::|
  Fly   343 EMPGASGAEVKGVCTEAGMYALRERRVHVTQEDFEMAVSKVMMKDSEK 390

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Rpt4NP_572308.3 RPT1 13..395 CDD:224143 180/374 (48%)
AAA 179..311 CDD:278434 83/132 (63%)
Rpt6RNP_651811.1 RPT1 3..396 CDD:224143 180/374 (48%)
AAA 180..311 CDD:278434 82/132 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C74463159
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D298123at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR23073
RoundUp 00.000 Not matched by this tool.
33.040

Return to query results.
Submit another query.