DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and Josd1

DIOPT Version :8

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_083068.1 Gene:Josd1 / 74158 MGIID:1921408 Length:202 Species:Mus musculus

Alignment Length:181 Identity:80/181 - (44%)
Similarity:116/181 - (64%) Gaps:7/181 - (3%)


  Fly    36 PHGIYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPH-RSWIGWGNYDVNVI 99
            |..||||:|.|.||.||||||:||..:.|::..|.:....|:|...:.|| :|.:|.||||||||
Mouse    23 PPQIYHEKQRRELCALHALNNVFQDSNAFTRETLQEIFQRLSPNTMVTPHKKSMLGNGNYDVNVI 87

  Fly   100 MYALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSYY 164
            |.|||.:..||||:|:|||...:.|:.:.|||:|:|:.:..| .:.||...:||:.:|.:.|:||
Mouse    88 MAALQTKGYEAVWWDKRRDVGVIALTNVMGFIMNLPSSLCWG-PLKLPLKRQHWICVREVGGAYY 151

  Fly   165 NLDSKLREPKCLGTEQQFLEFLATQLQ-MDHELFLVLDEETDCKDKSQQRW 214
            ||||||:.|:.:|.|.:..:||...|: .:.||.||:.||.:    :.|.|
Mouse   152 NLDSKLKMPEWIGGESELRKFLKYHLRGKNCELLLVVPEEVE----AHQSW 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 64/140 (46%)
Josd1NP_083068.1 Josephin 31..173 CDD:280299 64/142 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C283137852
eggNOG 1 0.900 E1_KOG2934
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002402
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_130817
Panther 1 1.100 LDO PTHR13291
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
76.800

Return to query results.
Submit another query.