DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and Josd2

DIOPT Version :8

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_006541134.1 Gene:Josd2 / 66124 MGIID:1913374 Length:227 Species:Mus musculus

Alignment Length:184 Identity:91/185 (49%)
Similarity:112/185 (61%) Gaps:13/185 (7%)


  Fly    36 PHGIYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPHRSWIGWGNYDVNVIM 100
            |..:|||||...||.:|||||:.| ..:||:...|:.|..|.|.:.||||||.:|.|||||||||
Mouse    50 PPSVYHERQRLELCAVHALNNVLQ-EQLFSQEAADEICKRLAPDSRLNPHRSLLGTGNYDVNVIM 113

  Fly   101 YALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSYYN 165
            .|||.....|||:||||....|.|..:.|.|||:|:.:||| .:.||...|||:|||:::|.|||
Mouse   114 AALQGLGLAAVWWDRRRPLSQLALPQVLGLILNLPSPVSLG-LLSLPLRRRHWVALRQVDGIYYN 177

  Fly   166 LDSKLREPKCLGTEQQFLEFLATQL-QMDHELFLVLD---EETDCKDKSQQRWL 215
            ||||||.|:.||.|.....|||..| |...|:.||:.   ||..|       ||
Mouse   178 LDSKLRAPEALGDEDGVRTFLAAALAQGLCEVLLVVTKEVEEAGC-------WL 224

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 73/140 (52%)
Josd2XP_006541134.1 Josephin 58..205 CDD:280299 78/149 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C283130494
eggNOG 1 0.900 E1_KOG2934
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 H26696
Inparanoid 1 1.050 160 1.000 Inparanoid score I4196
Isobase 00.000 Not matched by this tool.
OMA 1 1.010
OrthoDB 1 1.010 D1482722at2759
OrthoFinder 1 1.000 FOG0002402
OrthoInspector 1 1.000 T617144
orthoMCL 1 0.900 OOG5_130817
Panther 1 1.100 O PTHR13291
Phylome 1 0.910 0.762 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8572
TreeFam 1 0.960
1312.800

Return to query results.
Submit another query.