DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and atxn3

DIOPT Version :9

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:XP_012823853.1 Gene:atxn3 / 549143 XenbaseID:XB-GENE-971501 Length:357 Species:Xenopus tropicalis


Alignment Length:191 Identity:50/191 - (26%)
Similarity:78/191 - (40%) Gaps:43/191 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 IYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTLTPRNWL---------NPHRSWIGW--G 92
            |:||:|...||..|.||||.|| :.||..||......|..:..:         ..:|:::..  |
 Frog     4 IFHEKQEGSLCAQHCLNNLLQG-EYFSPVELSSIAMQLDEQERMRMAEGGVTSEDYRTFVQQPSG 67

  Fly    93 NYD------VNVIMYALQQRNCEAVWFDRRRDPHCLNLSV----IFGFILNVPAQMSLGYYIPLP 147
            |.|      :.||..||.....|...|:   .|...||.:    ...||.|              
 Frog    68 NMDDSGFFSIQVISDALSVWGLELTLFN---SPEYRNLGIDPINEKAFICN-------------- 115

  Fly   148 FHMRHWLALRRLNGSYYNLDSKLREPKCLGTEQQFLEFLATQLQMD-HELFLVLDEETDCK 207
             :..||..:|:|...::||:|.|..|:.:  ...:|.....|||.: :.:|:|..:..:|:
 Frog   116 -YKEHWFTVRKLGKQWFNLNSLLTGPELI--SDTYLALFLAQLQQEGYSIFVVKGDLPECE 173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 40/160 (25%)
atxn3XP_012823853.1 Josephin 9..163 CDD:280299 44/174 (25%)
SUIM_assoc 273..325 CDD:293225
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1482722at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.