DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3781 and josd1

DIOPT Version :8

Sequence 1:NP_572303.4 Gene:CG3781 / 31560 FlyBaseID:FBgn0029853 Length:221 Species:Drosophila melanogaster
Sequence 2:NP_001121477.1 Gene:josd1 / 100158575 XenbaseID:XB-GENE-1000778 Length:201 Species:Xenopus tropicalis

Alignment Length:182 Identity:81/183 (44%)
Similarity:117/183 (64%) Gaps:7/183 (4%)


  Fly    35 MPHGIYHERQTRHLCGLHALNNLFQGPDMFSKSELDDYCTTLTPRNWLNPH-RSWIGWGNYDVNV 98
            :|..||||:|.|.||.||||||:||....|::..|.:....|:|...:.|| ::.:|.|||||||
 Frog    21 LPPQIYHEKQRRELCALHALNNVFQDAGAFTRETLQEIFQRLSPNTLVTPHKKNVLGNGNYDVNV 85

  Fly    99 IMYALQQRNCEAVWFDRRRDPHCLNLSVIFGFILNVPAQMSLGYYIPLPFHMRHWLALRRLNGSY 163
            ||.|||.:..||||:|:|||.:.:.||.:.|||:|:|:.:|.| .:.||...:||:.:|.:.|:|
 Frog    86 IMAALQTKGYEAVWWDKRRDVNLICLSNVTGFIMNLPSSLSWG-PLKLPLKRQHWICVREVGGNY 149

  Fly   164 YNLDSKLREPKCLGTEQQFLEFLATQLQ-MDHELFLVLDEETDCKDKSQQRW 214
            |||||||:.|:.:|:|....:|....|: .:.||.||:.||.:.    .|||
 Frog   150 YNLDSKLKRPEWIGSEDDLRKFFRYHLRGKNCELLLVVPEEVEV----HQRW 197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG3781NP_572303.4 Josephin 44..184 CDD:280299 65/141 (46%)
josd1NP_001121477.1 Josephin 30..173 CDD:280299 66/144 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C283134070
eggNOG 1 0.900 E1_KOG2934
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 161 1.000 Inparanoid score I4026
OMA 1 1.010
OrthoDB 1 1.010 D1482722at2759
OrthoFinder 1 1.000 FOG0002402
OrthoInspector 1 1.000 T602178
Phylome 1 0.910 0.800 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R8572
TreeFam 1 0.960
1110.800

Return to query results.
Submit another query.