DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spx and emb2444

Sequence 1:NP_511058.1 Gene:Spx FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_179441.1 Gene:emb2444 AraportID:AT2G18510 Length:363 Species:Arabidopsis thaliana

Alignment Length:365 Identity:200/366 (55%)
Similarity:239/366 (65%) Gaps:51/366 (14%)


  Fly     7 AERNQDATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGI 71
            ||||||||:|.||||.::||.|||||||||||||||::||||||.:||.|||:|:.|||||||.|
plant    19 AERNQDATVYVGGLDAQLSEELLWELFVQAGPVVNVYVPKDRVTNLHQNYGFIEYRSEEDADYAI 83

  Fly    72 KIMNMIKLYGKPIRVNKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDP 136
            |::|||||:||||||||||..:|:||||||:||||||.:||||||||||||||||...|||||||
plant    84 KVLNMIKLHGKPIRVNKASQDKKSLDVGANLFIGNLDPDVDEKLLYDTFSAFGVIASNPKIMRDP 148

  Fly   137 ETGKSKSFAFINFASFEASDAAMDAMNGQYLCNRPISVSYAFKKDHKGERHGSAAERLLAAQNPS 201
            :||.|:.|.||::.||||||||:::|.||||.||.|:||||:|||.||||||:.|||||||.||:
plant   149 DTGNSRGFGFISYDSFEASDAAIESMTGQYLSNRQITVSYAYKKDTKGERHGTPAERLLAATNPT 213

  Fly   202 THADRPHQLFADAPVQTMMPQMPGQIPAQMPGQMMPPPMMAP--PPPVVPVSNNNMGMLAPPPPV 264
            ....|||.|||..| .:..||:.|.......|.|.|.|:.||  |||             |||.|
plant   214 AQKSRPHTLFAMGP-PSSAPQVNGLPRPFANGSMQPVPIPAPRQPPP-------------PPPQV 264

  Fly   265 --PQPAPFPA-----TIPPPPL---PPMTGGQPPLPPAMGI-----------PPPPRMM---QPN 305
              .||..:|:     ::.|||:   ||.  |.||.||...:           ||||:.|   |..
plant   265 YQTQPPSWPSQPQQHSMVPPPMQFRPPQ--GMPPPPPPQFLNHQQGFGGPRPPPPPQAMGMHQHG 327

  Fly   306 AWAPPGMPAPPPRPPPTNWRPP----PVPFPPTPYARPYQ 341
            .|.|..|  .....||...:||    .:..||.|   |:|
plant   328 GWPPQHM--QQQGGPPQQQQPPYQHHHMSMPPPP---PHQ 362

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 55/73 (75%)
RRM2_SF3B4 99..181 CDD:240781 60/82 (73%)
emb2444NP_179441.1 RRM1_SF3B4 27..100 CDD:240780 55/73 (75%)
RRM2_SF3B4 111..193 CDD:240781 60/82 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 358 1.000 Inparanoid score I581
OMA 1 1.010
OrthoDB 1 1.010 D1479417at2759
OrthoInspector 1 1.000 T192756
orthoMCL 1 0.900 OOG5_128231
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
65.970

Return to query results.
Submit another query.