DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Spx and pAbp

Sequence 1:NP_511058.1 Gene:Spx FlyBaseID:FBgn0015818 Length:347 Species:Drosophila melanogaster
Sequence 2:NP_476667.1 Gene:pAbp FlyBaseID:FBgn0265297 Length:634 Species:Drosophila melanogaster

Alignment Length:182 Identity:63/183 (34%)
Similarity:103/183 (56%) Gaps:5/183 (3%)


  Fly    13 ATIYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMI 77
            |::|.|.|...|:|:.|::.|..||||:::.:.:|.:|:...||.:|.|....||:..:..||..
  Fly     2 ASLYVGDLPQDVNESGLFDKFSSAGPVLSIRVCRDVITRRSLGYAYVNFQQPADAERALDTMNFD 66

  Fly    78 KLYGKPIRV--NKASAHQKNLDVGANIFIGNLDVEVDEKLLYDTFSAFGVILQTPKIMRDPETGK 140
            .:..||||:  ::.....:...|| |:||.|||..:|.|.:||||||||.||.. |:..| |.|.
  Fly    67 LVRNKPIRIMWSQRDPSLRRSGVG-NVFIKNLDRAIDNKAIYDTFSAFGNILSC-KVATD-EKGN 128

  Fly   141 SKSFAFINFASFEASDAAMDAMNGQYLCNRPISVSYAFKKDHKGERHGSAAE 192
            ||.:.|::|.:.||::.::|.:||..|..:.:.|.....:..:.:..|..|:
  Fly   129 SKGYGFVHFETEEAANTSIDKVNGMLLNGKKVYVGKFIPRKEREKELGEKAK 180

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SpxNP_511058.1 RRM1_SF3B4 15..88 CDD:240780 25/75 (33%)
RRM2_SF3B4 99..181 CDD:240781 34/82 (41%)
pAbpNP_476667.1 PABP-1234 2..625 CDD:130689 63/183 (34%)
RRM1_I_PABPs 3..82 CDD:240824 25/79 (32%)
RRM2_I_PABPs 88..164 CDD:240825 35/79 (44%)
RRM3_I_PABPs 182..262 CDD:240826
RRM4_I_PABPs 286..364 CDD:240827
PABP 557..624 CDD:279051
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C73527506
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR24012
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.