DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mipp2 and PHO5

DIOPT Version :8

Sequence 1:NP_511055.1 Gene:Mipp2 / 31544 FlyBaseID:FBgn0026060 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_009651.3 Gene:PHO5 / 852390 SGDID:S000000297 Length:467 Species:Saccharomyces cerevisiae

Alignment Length:428 Identity:85/429 (20%)
Similarity:164/429 (38%) Gaps:68/429 (16%)


  Fly     8 LFLLLLHFFVGVTLSEEGECRRLNRADIEGRLSTKT---PYRAIAN-YDETPPKYA-------GC 61
            :|..:::..:..:|:..|.......||:: ::.|:.   |:...|. |...|..|.       ||
Yeast     1 MFKSVVYSILAASLANAGTIPLGKLADVD-KIGTQKDIFPFLGGAGPYYSFPGDYGISRDLPEGC 64

  Fly    62 HPTRIWTIIRHGTRNPSESV---ILQAQNRLSEIKKRILDQTKPPICTAELEKLRQWHWMHLNAT 123
            ...::..:.|||.|.|:.|:   |.....:||...::.         ...|..|...:...:...
Yeast    65 EMKQLQMVGRHGERYPTVSLAKTIKSTWYKLSNYTRQF---------NGSLSFLNDDYEFFIRDD 120

  Fly   124 EDEKL--LVAEGEDELIELAERM--QRRFPDLLPE---LYNPEWYYFKYTA-TQRTLKSAESFAT 180
            :|.::  ..|..:|.|......|  :|...|.|.:   :...:..:..:|: ::|...:|:.|..
Yeast   121 DDLEMETTFANSDDVLNPYTGEMNAKRHARDFLAQYGYMVENQTSFAVFTSNSKRCHDTAQYFID 185

  Fly   181 GLFGRHRI--HTVRYPPPLHEDPVLRFYKGCGKWKTDVDKNPETLVNARRFLAEPQMQSAVEQVR 243
            ||..:..|  .||........: .|.....|..|  |.|.| :.:||.   .....:....:::.
Yeast   186 GLGDQFNITLQTVSEAESAGAN-TLSACNSCPAW--DYDAN-DDIVNE---YDTTYLDDIAKRLN 243

  Fly   244 SSTRLPDLQPEDVQLMYTVCAFETAWHRPRHDSGSKSSYESVWCNFFDVAALEALEFFEDLEYYW 308
            ...:..:|...|...:::.||||.          :...|..| |:.|....|....:::||..|:
Yeast   244 KENKGLNLTSTDASTLFSWCAFEV----------NAKGYSDV-CDIFTKDELVHYSYYQDLHTYY 297

  Fly   309 NDGYGYELTHRIACPAIADMF-AAISSSEETRQRRANATLYFTHSGTLLKLLAHLGLARDNKPLT 372
            ::|.||::...:.    :::| |::...:::..:.....|.|||...:|..|...|:..|...||
Yeast   298 HEGPGYDIIKSVG----SNLFNASVKLLKQSEIQDQKVWLSFTHDTDILNFLTTAGIIDDKNNLT 358

  Fly   373 HKHF-----ASERLWRTSQ-----IDAF-ATNLAFLRY 399
            .::.     ...|.|...|     .:.| .:|..::||
Yeast   359 AEYVPFMGNTFHRSWYVPQGARVYTEKFQCSNDTYVRY 396

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mipp2NP_511055.1 HP 68..351 CDD:299704 58/297 (20%)
PHO5NP_009651.3 His_Phos_2 65..399 CDD:306768 72/364 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C276975891
eggNOG 1 0.900 E1_KOG1382
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S5846
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_127769
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R957
TreeFam 00.000 Not matched by this tool.
65.710

Return to query results.
Submit another query.