DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mipp2 and Minpp1

DIOPT Version :8

Sequence 1:NP_511055.1 Gene:Mipp2 / 31544 FlyBaseID:FBgn0026060 Length:453 Species:Drosophila melanogaster
Sequence 2:NP_034929.1 Gene:Minpp1 / 17330 MGIID:1336159 Length:481 Species:Mus musculus

Alignment Length:474 Identity:128/475 (27%)
Similarity:207/475 (44%) Gaps:71/475 (15%)


  Fly    21 LSEEGECRRLNRAD-----IEGRLSTKTPYRAIAN----YDETPPK-----YAG-CHPTRIWTII 70
            ||....|....|.|     :.....|||.|.. ||    .|...|:     .|| |.|.::..:|
Mouse    24 LSSFARCSLPGRGDPVASVLSPYFGTKTRYED-ANPWLLVDPVAPRRDPELLAGTCTPVQLVALI 87

  Fly    71 RHGTRNPSESVILQAQNRLSEIKKRILDQTKPPICTAELEKLRQW-----HWMHLNATEDEKLLV 130
            |||||.|:...|.:.:.....::.|........:..|    |.:|     .||       :..||
Mouse    88 RHGTRYPTTKQIRKLKQLQGLLQTRESRDGGSQVAAA----LAEWPLWYGDWM-------DGQLV 141

  Fly   131 AEGEDELIELAERMQRRFPDLLPELYNPEWYYFKYTATQRTLKSAESFATGLFGRHR-------I 188
            .:|..::.:||.|:...||||... .|.:......::..|.:.|:.:|..||:..:.       :
Mouse   142 EKGRQDMRQLALRLAALFPDLFSR-ENYDRLRLITSSKHRCVDSSAAFLQGLWQHYHPGLPPPDV 205

  Fly   189 HTVRYPPPLHEDPVLRFYKGCGKWKTDVDKNPETLVNARRFLAEPQMQSAVEQVRSSTRLP--DL 251
            ..:...||...|.::||:..|.|:.|||::|...|.:...|...|:||..:::|.::.::|  .|
Mouse   206 SDMECGPPRINDKLMRFFDHCEKFLTDVERNETALYHVEAFKTGPEMQKVLKKVAATLQVPMNSL 270

  Fly   252 QPEDVQLMYTVCAFETA---WHRPRHDSGSKSSYESVWCNFFDVAALEALEFFEDLEYYWNDGYG 313
            ..:.:|:.:..|:|:.|   .|.|             ||:.|||.....||:..||:.||...||
Mouse   271 NADLIQVAFFTCSFDLAIKGVHSP-------------WCDVFDVDDARVLEYLNDLKQYWKRSYG 322

  Fly   314 YELTHRIACPAIADMFAAISSSEETRQR----RANATLYFTHSGTLLKLLAHLGLARDNKPLTHK 374
            |.:..|.:|....|:|..:..:.|.:||    .:...|.|.|:.|||.||:.:|..:|.:|||..
Mouse   323 YTINSRSSCNLFQDIFLHLDKAVEQKQRSQPVSSPVILQFGHAETLLPLLSLMGYFKDKEPLTAY 387

  Fly   375 HFASE--RLWRTSQIDAFATNLAFLRYDCDKGNP-----QVLVLHQERVVRLPGCPQDKDLCPLA 432
            :|..:  |.:|:..|..:|:||.|:.|.||....     |:.:|..|:|  ||.....:.:....
Mouse   388 NFEEQVNRKFRSGHIVPYASNLIFVLYHCDNAQSPEEQFQIQLLLNEKV--LPLAHSQRPVGLYE 450

  Fly   433 TLRRIYANSVDHCDREKMC 451
            .|:..|.:.:..|...|.|
Mouse   451 ELKTHYRDILQSCQTSKEC 469

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Mipp2NP_511055.1 HP 68..351 CDD:299704 78/304 (26%)
Minpp1NP_034929.1 HP_HAP_like 82..429 CDD:132717 101/372 (27%)
Prevents secretion from ER. {ECO:0000255|PROSITE-ProRule:PRU10138} 478..481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C276966598
eggNOG 1 0.900 E1_KOG1382
Hieranoid 1 1.000
Homologene 1 1.000 H37980
Inparanoid 1 1.050 153 1.000 Inparanoid score I4289
Isobase 1 0.950 0 Normalized mean entropy S5846
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0004968
OrthoInspector 1 1.000 T616922
orthoMCL 1 0.900 OOG5_127769
Panther 1 1.100 O PTHR20963
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R957
TreeFam 1 0.960
1211.820

Return to query results.
Submit another query.