DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4660 and YBR096W

Sequence 1:NP_572293.1 Gene:CG4660 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_009654.3 Gene:YBR096W SGDID:S000000300 Length:230 Species:Saccharomyces cerevisiae

Alignment Length:152 Identity:36/153 (24%)
Similarity:66/153 (43%) Gaps:48/153 (31%)


  Fly    66 YHMNNARYFRELDFAR----VDFYERTNL------YRTITGMGGSVFQGAATIRYRRFIRPFHRF 120
            :|.:|:.||.|||.:|    ...:::..|      |..:    .:||     ..:.:.|:||.::
Yeast    80 FHKSNSTYFAELDISRGNLMCKIFQKLMLNSKHYPYIPV----ANVF-----TNFLKEIKPFQKY 135

  Fly   121 NIISRIIYWDEQSLFMEHRF------------------------VRPSDKFVHCIAICRQRVIDV 161
            ::.||||.|||:.:::..||                        ::|.|...:| .:..::|..:
Yeast   136 SVSSRIICWDEKWIYVMSRFTIKKGTVLCSLSLTKYVLKDGRKTIKPKDALEYC-GLYNEKVAKI 199

  Fly   162 SMEAVMSELLPRTSSNGFRATV 183
            |.:.:  :||  |...||..||
Yeast   200 SEDNL--KLL--TERCGFHETV 217

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 28/130 (22%)
YBR096WNP_009654.3 4HBT 73..175 CDD:238329 24/104 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143179736
eggNOG 1 0.900 E1_KOG4366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003658
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12475
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4781
TreeFam 00.000 Not matched by this tool.
54.960

Return to query results.
Submit another query.