| Sequence 1: | NP_572293.1 | Gene: | CG4660 / 31542 | FlyBaseID: | FBgn0029839 | Length: | 261 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001116176.1 | Gene: | them6 / 569944 | ZFINID: | ZDB-GENE-070912-340 | Length: | 205 | Species: | Danio rerio | 
| Alignment Length: | 259 | Identity: | 73/259 - (28%) | 
|---|---|---|---|
| Similarity: | 110/259 - (42%) | Gaps: | 66/259 - (25%) | 
- Green bases have known domain annotations that are detailed below.
| 
 
  Fly     1 MEQLCYLALSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCHILDTTTVNGLCLTNDVDTLL 65 
  Fly    66 YHMNNARYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWD 130 
  Fly   131 EQSLFMEHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAG 195 
  Fly   196 GISNPAMDTSLAENGHGTTSGGAAGTGATASATAAHCLKLK-PSLPPELAKWIEYNDMSSKNLR 258  | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| CG4660 | NP_572293.1 | 4HBT_2 | 56..162 | CDD:290018 | 45/105 (43%) | 
| them6 | NP_001116176.1 | 4HBT_2 | 53..183 | CDD:290018 | 51/191 (27%) | 
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C170581718 | |
| Domainoid | 1 | 1.000 | 97 | 1.000 | Domainoid score | I7172 | 
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 1 | 1.000 | - | - | ||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 1 | 1.010 | - | - | QHG59462 | |
| OrthoDB | 1 | 1.010 | - | - | D1195870at2759 | |
| OrthoFinder | 1 | 1.000 | - | - | FOG0003421 | |
| OrthoInspector | 1 | 1.000 | - | - | mtm6532 | |
| orthoMCL | 1 | 0.900 | - | - | OOG6_106004 | |
| Panther | 1 | 1.100 | - | - | O | PTHR12475 | 
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 1 | 1.000 | - | - | X2773 | |
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 12 | 11.860 | |||||