DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4660 and them6

Sequence 1:NP_572293.1 Gene:CG4660 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001116176.1 Gene:them6 ZFINID:ZDB-GENE-070912-340 Length:205 Species:Danio rerio

Alignment Length:259 Identity:73/260 (28%)
Similarity:110/260 (42%) Gaps:66/260 (25%)


  Fly     1 MEQLCYLALSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCHILDTTTVNGLCLTNDVDTLL 65
            ||.:....:.|||   :::..|::.|:||..|.|..|.|:.....:....|.:|..:.||:|  |
Zfish     1 MEDVLLWVVGVLL---LLFCTLDVWYYLRAVLVVTKAWFLSPVFDVTGEQTASGRVVLNDID--L 60

  Fly    66 YHMNNARYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWD 130
            .|||||||.||.||||:..|.|..:::.:..:|.:...||.||||||.:.....|.:.|||:.||
Zfish    61 CHMNNARYLRECDFARLSLYTRNGVFKALRALGATAVVGATTIRYRRPLCVGEAFELRSRIVSWD 125

  Fly   131 EQSLFMEHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAG 195
            |:|.::|.|||...|..|..:..|:|.|:..:.:.::..|..|                      
Zfish   126 EKSFYLEQRFVSCKDGMVSAVMFCKQNVLRSTPDKILQYLCKR---------------------- 168

  Fly   196 GISNPAMDTSLAENGHGTTSGGAAGTGATASATAAHCLKLK-PSLPPELAKWIEYNDMSSKNLR 258
                                                  |:: |..|.:|..||.:...|||.||
Zfish   169 --------------------------------------KVEVPEFPEDLQHWINFITASSKALR 194

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 45/106 (42%)
them6NP_001116176.1 4HBT_2 53..183 CDD:290018 52/192 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143177164
eggNOG 1 0.900 E1_KOG4366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195870at2759
OrthoFinder 1 1.000 FOG0003658
OrthoInspector 1 1.000 T128828
orthoMCL 1 0.900 OOG5_146550
Panther 1 1.100 O PTHR12475
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4781
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
98.830

Return to query results.
Submit another query.