DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4660 and THEM6

Sequence 1:NP_572293.1 Gene:CG4660 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_057731.1 Gene:THEM6 HGNCID:29656 Length:208 Species:Homo sapiens

Alignment Length:252 Identity:71/253 (28%)
Similarity:105/253 (42%) Gaps:62/253 (25%)


  Fly     9 LSVLLAI-IVVYGLLELHYFLRMCLCVLLARFVKRRCH-ILDTTTVNGLCLTNDVDTLLYHMNNA 71
            |..|||: :.|:.||::.|.:|:...||.||.::.|.. :|......|..|.:|:| ||.|||||
Human     5 LVALLALGLAVFALLDVWYLVRLPCAVLRARLLQPRVRDLLAEQRFPGRVLPSDLD-LLLHMNNA 68

  Fly    72 RYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWDEQSLFM 136
            ||.||.|||||....|..:...:..:.......|:..|:||.:|....|.:.:|::.||:::.::
Human    69 RYLREADFARVAHLTRCGVLGALRELRAHTVLAASCARHRRSLRLLEPFEVRTRLLGWDDRAFYL 133

  Fly   137 EHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAGGISNPA 201
            |.|||...|.||..:...||.::..|.|.|:..|..|...                         
Human   134 EARFVSLRDGFVCALLRFRQHLLGTSPERVVQHLCQRRVE------------------------- 173

  Fly   202 MDTSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLR 258
                                              .|.||.:|..||.||:.||:.||
Human   174 ----------------------------------PPELPADLQHWISYNEASSQLLR 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 38/106 (36%)
THEM6NP_057731.1 4HBT_2 54..185 CDD:315859 48/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143177085
eggNOG 1 0.900 E1_KOG4366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 123 1.000 Inparanoid score I4664
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195870at2759
OrthoFinder 1 1.000 FOG0003658
OrthoInspector 1 1.000 T610344
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12475
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4781
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
98.980

Return to query results.
Submit another query.