DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4660 and Them6

Sequence 1:NP_572293.1 Gene:CG4660 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001007659.1 Gene:Them6 RGDID:1359378 Length:207 Species:Rattus norvegicus

Alignment Length:260 Identity:73/261 (28%)
Similarity:108/261 (41%) Gaps:64/261 (25%)


  Fly     1 MEQLCYLALSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCH-ILDTTTVNGLCLTNDVDTL 64
            |.:|..::||:.||.   :.||:..|.:|:...||.||.::.|.. :|......|..|.:|:| |
  Rat     1 MMELLVVSLSLALAF---FALLDGWYLVRVPCAVLRARLLQPRVRDLLAEQLYAGRVLPSDLD-L 61

  Fly    65 LYHMNNARYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYW 129
            |.|||||||.||.|.||.....|..:...:..:|......|:..||||.:|.|..|.:.:|::.|
  Rat    62 LLHMNNARYLREADVARAAHLTRCGVLGALRDLGAHTVLAASCARYRRSLRLFEPFEVHTRLLGW 126

  Fly   130 DEQSLFMEHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAA 194
            |:::.::|.|||...|.||..:...||.|:..|.:.|:..|..|...                  
  Rat   127 DDRAFYLEARFVSLRDGFVCALLRFRQHVLGTSPDRVVQHLCKRRVE------------------ 173

  Fly   195 GGISNPAMDTSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLRS 259
                                                     .|.||.:|..||.||:.||:.||:
  Rat   174 -----------------------------------------PPELPEDLKHWITYNETSSQLLRA 197

  Fly   260  259
              Rat   198  197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 40/106 (38%)
Them6NP_001007659.1 4HBT_2 54..185 CDD:290018 49/191 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143177102
eggNOG 1 0.900 E1_KOG4366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 118 1.000 Inparanoid score I4627
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195870at2759
OrthoFinder 1 1.000 FOG0003658
OrthoInspector 1 1.000 T619263
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12475
Phylome 00.000 Not matched by this tool.
TreeFam 1 0.960
87.950

Return to query results.
Submit another query.