DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4660 and Them6

Sequence 1:NP_572293.1 Gene:CG4660 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_941009.1 Gene:Them6 MGIID:1925301 Length:207 Species:Mus musculus

Alignment Length:260 Identity:72/261 (28%)
Similarity:105/261 (40%) Gaps:64/261 (25%)


  Fly     1 MEQLCYLALSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCH-ILDTTTVNGLCLTNDVDTL 64
            |.:|...:||:.||.   :.||:..|.:|:...||.||.::.|.. :|......|..|.:|:| |
Mouse     1 MLELLVASLSLALAF---FALLDGWYLVRVPCAVLRARLLQPRVRDLLAEQRYAGRVLPSDLD-L 61

  Fly    65 LYHMNNARYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYW 129
            |.|||||||.||.|.||.....|..:...:..:.......|:..||||.:|.|..|.:.:|:..|
Mouse    62 LLHMNNARYLREADVARAAHLTRCGVLGALRDLNAHTVLAASCARYRRSLRLFEPFEVHTRLQGW 126

  Fly   130 DEQSLFMEHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAA 194
            |:::.::|.|||...|.||..:...||.|:..|.:.|:..|..|...                  
Mouse   127 DDRAFYLEARFVSLRDGFVCALLRFRQHVLGTSPDRVVQHLCKRRVE------------------ 173

  Fly   195 GGISNPAMDTSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLRS 259
                                                     .|.||.:|..||.||:.||:.||:
Mouse   174 -----------------------------------------PPELPEDLKHWISYNETSSQLLRA 197

  Fly   260  259
            Mouse   198  197

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 39/106 (37%)
Them6NP_941009.1 4HBT_2 54..185 CDD:315859 48/191 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143175961
eggNOG 1 0.900 E1_KOG4366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4756
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0003658
OrthoInspector 1 1.000 T617147
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12475
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4781
TreeFam 1 0.960
87.970

Return to query results.
Submit another query.