DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4660 and them6

Sequence 1:NP_572293.1 Gene:CG4660 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001119977.1 Gene:them6 XenbaseID:XB-GENE-6455857 Length:206 Species:Xenopus tropicalis

Alignment Length:258 Identity:76/259 (29%)
Similarity:116/259 (45%) Gaps:76/259 (29%)


  Fly    11 VLLA--IIVVYGLLELHYFLRMCLCVLLAR-------FVKRRCHILDTTTVNGLCLTNDVDTLLY 66
            |||:  |..::.||::.||:|..|.||.||       .:|..|:       .|:.|.:|:| .|:
 Frog     5 VLLSGLIAAIFSLLDVWYFVRGALVVLKARIQPVVKDLLKEHCY-------GGIVLPHDLD-FLF 61

  Fly    67 HMNNARYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWDE 131
            ||||:||.||.||||...:.|:.|::.:..:|..:....:||||||.:|....|.|.:|::.||:
 Frog    62 HMNNSRYLREADFARFAHFTRSGLFQAVRYLGAGMVMAGSTIRYRRSLRLLETFEIRTRLLCWDD 126

  Fly   132 QSLFMEHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAGG 196
            ::.::|.|||.|.|.||..:.:.||.||..|.:.|:..:..|...:                   
 Frog   127 KAFYVEQRFVAPKDDFVCAVLLSRQHVIGNSPDKVVQSMCKRKVES------------------- 172

  Fly   197 ISNPAMDTSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLRS 259
                                                    |..|.|:|.||:|||.||:.||:
 Frog   173 ----------------------------------------PEYPEEVAHWIKYNDASSQQLRA 195

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 43/106 (41%)
them6NP_001119977.1 4HBT_2 52..183 CDD:290018 51/191 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 148 1.000 Inparanoid score I4174
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195870at2759
OrthoFinder 1 1.000 FOG0003658
OrthoInspector 1 1.000 T602181
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4781
TreeFam 00.000 Not matched by this tool.
55.090

Return to query results.
Submit another query.