DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4660 and si:ch73-52e5.2

Sequence 1:NP_572293.1 Gene:CG4660 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_017212901.1 Gene:si:ch73-52e5.2 ZFINID:ZDB-GENE-070912-341 Length:207 Species:Danio rerio

Alignment Length:258 Identity:71/259 (27%)
Similarity:106/259 (41%) Gaps:62/259 (24%)


  Fly     4 LCY--LALSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCHILDTTTVNGLCLTNDVDTLLY 66
            :|:  :.|..|...::::|..::.||||.....|...|......:|....|:|..|.:|:| .:.
Zfish     1 MCHRIMLLWFLSGSLLLFGTFDVWYFLRGLWVALRCCFQSPIRDVLAEQVVHGRVLLHDMD-FMC 64

  Fly    67 HMNNARYFRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWDE 131
            |||||||.||.||||.....|..|:.....:..::..||.||||||.:.....|.:.:||:.|||
Zfish    65 HMNNARYLRECDFARFAHGTRIGLFMAARALKATMVVGATTIRYRRSLALGEGFELRTRIVSWDE 129

  Fly   132 QSLFMEHRFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAGG 196
            :|.::|.|||..||.|:..:.:|||.||..|.:.::..|..|                       
Zfish   130 KSFYLEQRFVSKSDGFISAVMLCRQNVIRGSPQNILEFLCKR----------------------- 171

  Fly   197 ISNPAMDTSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLRS 259
                                            ...|    |.:..||..||.:...||:.||:
Zfish   172 --------------------------------KVDC----PDISEELQHWIRFISASSQALRA 198

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 45/106 (42%)
si:ch73-52e5.2XP_017212901.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143177354
eggNOG 1 0.900 E1_KOG4366
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195870at2759
OrthoFinder 1 1.000 FOG0003658
OrthoInspector 1 1.000 T128828
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 LDO PTHR12475
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4781
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
87.930

Return to query results.
Submit another query.