DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4666 and CG4660

Sequence 1:NP_001284923.1 Gene:CG4666 FlyBaseID:FBgn0029838 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_572293.1 Gene:CG4660 FlyBaseID:FBgn0029839 Length:261 Species:Drosophila melanogaster

Alignment Length:250 Identity:74/250 (30%)
Similarity:123/250 (49%) Gaps:60/250 (24%)


  Fly     1 MSWLVVLLILYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTIYGLCTSQDVDIFIRHMNNARY 65
            :|.|:.::::|.:.:::||:|....|...|..:|:..:.||||:.|||.:.|||..:.|||||||
  Fly     9 LSVLLAIIVVYGLLELHYFLRMCLCVLLARFVKRRCHILDTTTVNGLCLTNDVDTLLYHMNNARY 73

  Fly    66 LRELDFARFHFYALTGLYERIRDRRGGAVQGASSVRYRRTIPIFHPYKIQTKLIWWDDKAIYLEQ 130
            .|||||||..||..|.||..|....|...|||:::||||.|..||.:.|.:::|:||::::::|.
  Fly    74 FRELDFARVDFYERTNLYRTITGMGGSVFQGAATIRYRRFIRPFHRFNIISRIIYWDEQSLFMEH 138

  Fly   131 QFITLSDGFVRAVAMSKQNITNCNVLEVL-KTYPETAQ--------------------------- 167
            :|:..||.||..:|:.:|.:.:.::..|: :..|.|:.                           
  Fly   139 RFVRPSDKFVHCIAICRQRVIDVSMEAVMSELLPRTSSNGFRATVLTSLAAPSPAAGGISNPAMD 203

  Fly   168 --------------------------------RPEKPEELKLWLDAIELSSQKLR 190
                                            :|..|.||..|::..::||:.||
  Fly   204 TSLAENGHGTTSGGAAGTGATASATAAHCLKLKPSLPPELAKWIEYNDMSSKNLR 258

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4666NP_001284923.1 4HBT_2 48..179 CDD:290018 55/191 (29%)
CG4660NP_572293.1 4HBT_2 56..162 CDD:290018 47/106 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C143171830
eggNOG 1 0.900 E1_KOG4366
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 117 1.000 Inparanoid score I4756
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195870at2759
OrthoFinder 1 1.000 FOG0003658
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR12475
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4781
77.020

Return to query results.
Submit another query.