DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: CG4666 and them6

Sequence 1:NP_001284923.1 Gene:CG4666 FlyBaseID:FBgn0029838 Length:193 Species:Drosophila melanogaster
Sequence 2:NP_001119977.1 Gene:them6 XenbaseID:XB-GENE-6455857 Length:206 Species:Xenopus tropicalis

Alignment Length:197 Identity:72/198 (36%)
Similarity:118/198 (60%) Gaps:6/198 (3%)


  Fly     1 MSWLVVL--LI--LYVIWDVNYFIRCVFTVFAGRLFQRKRKVTDTTTIYGLCTSQDVDIFIRHMN 61
            |.:||:|  ||  ::.:.||.||:|....|...|:....:.:.......|:....|:| |:.|||
 Frog     1 MLFLVLLSGLIAAIFSLLDVWYFVRGALVVLKARIQPVVKDLLKEHCYGGIVLPHDLD-FLFHMN 64

  Fly    62 NARYLRELDFARFHFYALTGLYERIRDRRGGAVQGASSVRYRRTIPIFHPYKIQTKLIWWDDKAI 126
            |:|||||.|||||..:..:||::.:|....|.|...|::||||::.:...::|:|:|:.|||||.
 Frog    65 NSRYLREADFARFAHFTRSGLFQAVRYLGAGMVMAGSTIRYRRSLRLLETFEIRTRLLCWDDKAF 129

  Fly   127 YLEQQFITLSDGFVRAVAMSKQNITNCNVLEVLKTY-PETAQRPEKPEELKLWLDAIELSSQKLR 190
            |:||:|:...|.||.||.:|:|::...:..:|:::. ....:.||.|||:..|:...:.|||:||
 Frog   130 YVEQRFVAPKDDFVCAVLLSRQHVIGNSPDKVVQSMCKRKVESPEYPEEVAHWIKYNDASSQQLR 194

  Fly   191 KD 192
            .:
 Frog   195 AE 196

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CG4666NP_001284923.1 4HBT_2 48..179 CDD:290018 53/132 (40%)
them6NP_001119977.1 4HBT_2 52..183 CDD:290018 53/132 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000
Homologene 1 1.000 H105296
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1195870at2759
OrthoFinder 1 1.000 FOG0003658
OrthoInspector 1 1.000 T602181
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4781
TreeFam 00.000 Not matched by this tool.
66.040

Return to query results.
Submit another query.