DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsp5D and Tsp97E

Sequence 1:NP_001259266.1 Gene:Tsp5D FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001263002.1 Gene:Tsp97E FlyBaseID:FBgn0039465 Length:228 Species:Drosophila melanogaster

Alignment Length:271 Identity:54/272 (20%)
Similarity:98/272 (36%) Gaps:60/272 (22%)


  Fly     5 GYTCIRRTFCWLNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSF 69
            |:||.:.....|||:..:.....:|.|::.|.  |...|.||...|:.|..:.:      ..:|.
  Fly     4 GFTCSKNALIALNILYVMIGFLLIGVGVYARA--ASIVTNLPIVGGILACGVIL------ICISM 60

  Fly    70 FGCCGAWVQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGS 134
            .|..||....:.:|..|.:::.|||:.:|.:.|..              |....|:....:::|.
  Fly    61 LGLAGAVKHHQVMLFFYMIILFMLFLIQFSIASSC--------------LAVNSEQQQQFAEQGW 111

  Fly   135 LVAPSVASIWDSVQQSFECCGVS----SYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGD 195
            :..|:  .:...||.|.:|||.:    |........:.|....:.:.||.               
  Fly   112 MTVPT--DLRKQVQDSLKCCGFNATAPSTTSVVPPSNEPSCELINQQCCA--------------- 159

  Fly   196 GMMRPDCGRSENPSLWWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKR 260
            ....||| |.|        .|...|:........:.|.:|:..:|.::      :.:|...:::.
  Fly   160 HSSEPDC-RCE--------PCGPLLEDKIDYAFKLCGGLGIFFSFTEV------LAVFLARRYRN 209

  Fly   261 ASDTYKSYSPS 271
            ..|  ..|.|:
  Fly   210 QHD--PCYLPA 218

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 49/252 (19%)
NET-5_like_LEL 105..228 CDD:239418 21/127 (17%)
Tsp97ENP_001263002.1 Tetraspannin 7..204 CDD:278750 49/251 (20%)
tetraspanin_LEL <121..177 CDD:243179 17/80 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.