DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsp5D and lbm

Sequence 1:NP_001259266.1 Gene:Tsp5D FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_001260757.1 Gene:lbm FlyBaseID:FBgn0016032 Length:208 Species:Drosophila melanogaster

Alignment Length:258 Identity:56/259 (22%)
Similarity:94/259 (36%) Gaps:93/259 (36%)


  Fly    40 GYATLLPQHAGLSADTI--FMGIGGTG------------FVVSFFGCC---------GAWVQSR- 80
            |.||...:.|.:..:.:  |:..|..|            ||::.:..|         |.:...| 
  Fly     2 GCATTSVKIASIVLNAVLGFLAAGAIGWIAYNADTETEEFVIAAYIACSLILVFALLGIFAAIRE 66

  Fly    81 ----------CLLVLYFMLIV--MLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRG 133
                      .||:|..:.||  .||:.||.|.|         ||.:       :|..:.:::  
  Fly    67 SVVLTATSAVFLLILAILQIVSTCLFLHEFDVKS---------GRDM-------VEVAWQANN-- 113

  Fly   134 SLVAPSVASIWDSVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMM 198
                      .||:||..||||.||.:|:..:.     ..:|.||              ..|...
  Fly   114 ----------MDSLQQKHECCGQSSAQDYIHLS-----LLIPPSC--------------YADLQQ 149

  Fly   199 RPDCGRSENPSLWWDKGCAHSLQSWF-TGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKR 260
            .||       .|:.| ||...:||:: :.:|..:....:.:|| :|.....::.|..:.|:|:
  Fly   150 TPD-------HLYLD-GCIEKVQSFYESDKLRFIIVSWVLVAF-ELICFALAVFLAISFKNKQ 203

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 54/253 (21%)
NET-5_like_LEL 105..228 CDD:239418 26/124 (21%)
lbmNP_001260757.1 Tetraspannin 8..198 CDD:278750 51/246 (21%)
tetraspanin_LEL <109..169 CDD:239401 23/99 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.