DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsp5D and Tsp42Ef

Sequence 1:NP_001259266.1 Gene:Tsp5D FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_523632.2 Gene:Tsp42Ef FlyBaseID:FBgn0033127 Length:220 Species:Drosophila melanogaster

Alignment Length:253 Identity:55/254 (22%)
Similarity:106/254 (42%) Gaps:47/254 (19%)


  Fly    16 LNIILWLCSCAFLGAGLWLRLSYAGYATLLPQHAGLSADTIFMGIGGTGFVVSFFGCCGAWVQSR 80
            |:::..|.:...:..|:::.:||.     |.:...|:|.. ::|:|....:|..:|...||.::.
  Fly    14 LDVLCTLLALVLISFGIYVAVSYN-----LNEIGQLTAYG-YVGLGAAALLVVLWGYLSAWRENV 72

  Fly    81 CLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTLANELRFGIERHYNSSDRGSLVAPSVASIWD 145
            |..|.:.:.:.::.:::|.|..:.......:...|||.|....|...||        |...|:: 
  Fly    73 CCTVTFIIFLCLVIIAQFAVVYLLITQEKTVASNLANALEATWEEELNS--------PGAMSLY- 128

  Fly   146 SVQQSFECCGVSSYEDWYDIQSWPGRRWVPESCCRTLYDQRQVLTEGSGDGMMRPDCGRSENPSL 210
              |..|:|||..|.:|:...:..|     ||:|.|. :|      :...:.::...| |.|..:.
  Fly   129 --QNWFQCCGRGSPQDYIVNERLP-----PETCFRN-HD------KSKPENLIHTGC-RVEFENY 178

  Fly   211 WWDKGCAHSLQSWFTGQLNVVGAVGLGIAFVQLFGLITSMLLFCTVKHKRASDTYKSY 268
            |          ...|...|::..|.:|      |.|:.| ::.|.:.:...:|..:||
  Fly   179 W----------QHLTKIFNILALVLIG------FELLLS-VISCRLCNSIRNDARRSY 219

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 52/240 (22%)
NET-5_like_LEL 105..228 CDD:239418 27/123 (22%)
Tsp42EfNP_523632.2 Tetraspannin 7..211 CDD:278750 52/244 (21%)
tetraspanin_LEL 103..181 CDD:239401 26/112 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.