DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Tsp5D and Tsp68C

Sequence 1:NP_001259266.1 Gene:Tsp5D FlyBaseID:FBgn0029837 Length:287 Species:Drosophila melanogaster
Sequence 2:NP_729926.1 Gene:Tsp68C FlyBaseID:FBgn0043550 Length:362 Species:Drosophila melanogaster

Alignment Length:347 Identity:81/348 (23%)
Similarity:133/348 (38%) Gaps:89/348 (26%)


  Fly    14 CWLN--IILWLCSCAFLGAGLWLRLS--YA---GYATLLPQHAGLSADT-----------IFMGI 60
            |..|  .:|.||:..||..||.|.:|  |.   ....||.:....|:|.           |.:|:
  Fly     3 CCFNYKFVLNLCNFLFLICGLLLVVSGLYIFSDNKRILLSRLLAASSDRLSSLPQPLLFYIALGV 67

  Fly    61 GGTGFVVSFFGCCGAW---VQSRCLLVLYFMLIVMLFMSEFLVGSIAFLFRGGLGRTL-ANELRF 121
            ...|||.:.....|.|   :.:.|.|.:||:.:|:|.::|.::.....|:...||.:| ..::..
  Fly    68 AIAGFVATLAAVVGFWASCLHTYCFLTIYFLSVVVLLLTESVLCLAITLWPHCLGISLDETQMVR 132

  Fly   122 GIERHYNSSDRGSLVAPSVASIWDSVQQSFECCGVSSYEDWYD-----IQSWPGRRW-VPESCCR 180
            .::.:|     |........:..|..|..|.|||:.|..| ||     :|.:..|.| ||.||| 
  Fly   133 SLQSNY-----GVPGQEQFTNALDLAQVRFGCCGMRSSLD-YDTSLWRLQGYGQRNWPVPLSCC- 190

  Fly   181 TLYDQRQVLTEGSGDGMMRPD--------CGRSENPSLWWDK---GCAHSLQSWFTGQLNVVGAV 234
                    ..:.:|..|...|        |...|..|...::   .|...|.:|:..|.::....
  Fly   191 --------FLKNAGHSMAYLDPKPANESMCQSLERLSYERERHTESCLPHLDNWYREQYSIFLGA 247

  Fly   235 GLGIAFVQLFGLITSMLLFCT-VKHKRA----------SDTYKS--------YSPSID------- 273
            .|.:|.:: |.::.::::.|| :..:||          :...||        |.|.::       
  Fly   248 SLILAMIE-FCVLLAIIMSCTGLASQRARLKKPVQEMRTQKVKSRQTLIENIYEPDVELRENSNH 311

  Fly   274 --------PQTRTSSWEDXTRL 287
                    |.:|..|.|| ..|
  Fly   312 SGDGIYLGPASRHVSSEDFKEL 333

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Tsp5DNP_001259266.1 Tetraspannin 8..256 CDD:278750 69/282 (24%)
NET-5_like_LEL 105..228 CDD:239418 34/141 (24%)
Tsp68CNP_729926.1 Tetraspannin 8..267 CDD:278750 66/275 (24%)
tetraspanin_LEL 117..241 CDD:239401 33/139 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR19282
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.