DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and SAS2

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_013846.1 Gene:SAS2 SGDID:S000004734 Length:338 Species:Saccharomyces cerevisiae

Alignment Length:319 Identity:111/320 (35%)
Similarity:174/320 (54%) Gaps:37/320 (12%)


  Fly   518 KSHAELTATQAALEKEH-ESITKIKYIDKLQFG-NYEIDTW-----YFSPFPEEYGKAR------ 569
            |..|::..||    ||. ..|...:.|.::||| |.:..||     ||.|..:..|.:.      
Yeast    28 KPSAKIKKTQ----KEMLYGILNERNIRQIQFGLNKKFSTWYGSAVYFDPETKRLGCSETKGQLS 88

  Fly   570 ----------TLYVCEYCLKYMRFRSSYAYHLHECD-RRRPPGREIYRKGNISIYEVNGKEESLY 623
                      ||:|||||.||...::.:..|:..|. :.|.||:..|:....:|..|.|.:..|:
Yeast    89 SVSNSQYWLDTLFVCEYCFKYTDDQTRFVGHVASCPFQYRVPGKIKYKSPEYTIRRVKGSKYQLF 153

  Fly   624 CQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQ 688
            ||.|||..||:||:|.:||.:|.:.|||:.||.  .:..:|:|||:..|.:..|:||||:.||:|
Yeast   154 CQCLCLFTKLYLDNKSMYFKVDHYEFYIVYETG--STKPMGFFSKDLVSYQQNNLACILIFPPYQ 216

  Fly   689 RKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLL-ELMKTRCAP-EQITIKEL 751
            |:|.|.|||.|||:||:.||||..||.|||..|.:.|..||:..|. .|::...|. :::|:::|
Yeast   217 RRGLGLLLIEFSYKLSQLEGVISGPEVPLSPFGLIGYLKYWSQILCWHLIEGDLAHYDKVTLEDL 281

  Fly   752 SEMSGITHDDIIYTLQSMKMIKYWKGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLV 810
            |.::|:..:|:|.||:.:..|    |:| ..:..:::...|:|...|:....:..:||:
Yeast   282 SIVTGMRVNDVILTLKHLNCI----GEN-NQIYLQSLNSWLKLHGTKRNWFKLKDEYLL 335

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553
NAT_SF 528..813 CDD:302625 107/310 (35%)
MOZ_SAS 599..778 CDD:280097 75/181 (41%)
SAS2NP_013846.1 NAT_SF 97..302 CDD:302625 85/207 (41%)
MOZ_SAS 130..306 CDD:280097 76/183 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S799
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.850

Return to query results.
Submit another query.