DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and ESA1

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_014887.3 Gene:ESA1 SGDID:S000005770 Length:445 Species:Saccharomyces cerevisiae

Alignment Length:472 Identity:170/473 (36%)
Similarity:266/473 (56%) Gaps:39/473 (8%)


  Fly   352 MEHDNTSRETV---ITTGDPLMQKID--ISENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPDE 411
            |.||......:   |.:.|.::.|..  :.:|.::           ...::|...|.:   ||.:
Yeast     1 MSHDGKEEPGIAKKINSVDDIIIKCQCWVQKNDEE-----------RLAEILSINTRK---APPK 51

  Fly   412 YYVHYVGLNRRLDGWVGRHRISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSER 476
            :|||||..|:|||.|:...||:           |....|.|...:|..:...|:...|...|...
Yeast    52 FYVHYVNYNKRLDEWITTDRIN-----------LDKEVLYPKLKATDEDNKKQKKKKATNTSETP 105

  Fly   477 QKRAANKDYYLSYCENSRYDYSDRKMTRYQKRRYDEINHVQKSHAELTATQAALEKEHESITKIK 541
            |....:.....|. ||:  |..|......|..:.:.|:| :....:|..:.:..:..|| :.:::
Yeast   106 QDSLQDGVDGFSR-ENT--DVMDLDNLNVQGIKDENISH-EDEIKKLRTSGSMTQNPHE-VARVR 165

  Fly   542 YIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYR 606
            .::::..|.|||:.|||||:|.|......:|:.::.|:|...:..|..:..:|..|.|||.||||
Yeast   166 NLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYR 230

  Fly   607 KGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKK 671
            ...:|.:|::|:::..:|:.|||::|||||||.||:|:||||||.:...|:.|.|:||||||||:
Yeast   231 DDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKE 295

  Fly   672 SLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLEL 736
            |.:.|||||||.||.:||.|:|||||.||||||:||..:|||||||||||.||||:||:.||:.|
Yeast   296 SADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITL 360

  Fly   737 MKTRCAPEQITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQNVICVTSKTIQDHLQLPQFKQPK 801
            :...  .::|||.|:|.|:.:|..||::|.:::.:::|:|||::|.:....:..:.:|...|  :
Yeast   361 LVEH--QKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKK--R 421

  Fly   802 LTIDTDYLVWSPQTAAA 818
            .|||.:.|:|.|....|
Yeast   422 RTIDPNRLIWKPPVFTA 438

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 15/50 (30%)
NAT_SF 528..813 CDD:302625 128/285 (45%)
MOZ_SAS 599..778 CDD:280097 100/179 (56%)
ESA1NP_014887.3 SAS2 16..431 CDD:227360 163/449 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S799
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0001140
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126735
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R415
TreeFam 00.000 Not matched by this tool.
54.780

Return to query results.
Submit another query.