DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and KAT8

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_892003.2 Gene:KAT8 HGNCID:17933 Length:467 Species:Homo sapiens

Alignment Length:438 Identity:234/439 (53%)
Similarity:310/439 (71%) Gaps:49/439 (11%)


  Fly   366 GDPLMQKIDISENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPDEYYVHYVGLNRRLDGWVGRH 430
            |:|.: .::|.|.    |..||.|.|.|..:|:|||..:.... :|:||||||.|||||.||.::
Human    49 GEPEV-TVEIGET----YLCRRPDSTWHSAEVIQSRVNDQEGR-EEFYVHYVGFNRRLDEWVDKN 107

  Fly   431 RISDNADDLGGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRY 495
            |::                            |.:....|...:||:         |||    ...
Human   108 RLA----------------------------LTKTVKDAVQKNSEK---------YLS----ELA 131

  Fly   496 DYSDRKMTRYQKRRYDEINHVQKSHAELTATQAALEKEHESITKIKYIDKLQFGNYEIDTWYFSP 560
            :..:||:||.|||::||||||||::||:..|.||||||||:|||:||:||:..||||||.|||||
Human   132 EQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSP 196

  Fly   561 FPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQ 625
            |||:|||...|::||||||||::..||.:||.:|..|:|||:|||||.|||:|||:||:..:|||
Human   197 FPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQ 261

  Fly   626 LLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRK 690
            .|||:||||||||.||||::||:||||.|.|::|:||||||||||:|.:..||||||.|||:||:
Human   262 NLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRR 326

  Fly   691 GFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMS 755
            |:||.|||||||||:.|..:|||||||||||:|||||||::.|||::  |.....::||:||:|:
Human   327 GYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEIL--RDFRGTLSIKDLSQMT 389

  Fly   756 GITHDDIIYTLQSMKMIKYWKGQNVICVTSKTIQDHLQLPQFKQPKLT 803
            .||.:|||.||||:.|:||||||:|||||.|.:::||:..|:|:|.:|
Human   390 SITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPIT 437

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 25/50 (50%)
NAT_SF 528..813 CDD:302625 180/277 (65%)
MOZ_SAS 599..778 CDD:280097 120/179 (67%)
KAT8NP_892003.2 PLN00104 15..429 CDD:215056 230/429 (54%)
Tudor-knot 55..111 CDD:288553 27/89 (30%)
NAT_SF 160..427 CDD:302625 177/269 (66%)
Acetyl-CoA binding. {ECO:0000269|PubMed:21217699, ECO:0000269|Ref.21} 317..319 2/2 (100%)
Acetyl-CoA binding. {ECO:0000269|PubMed:21217699, ECO:0000269|Ref.21} 324..330 4/6 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C235228652
eggNOG 1 0.900 E1_COG5027
Hieranoid 1 1.000
Homologene 1 1.000 H41676
Inparanoid 1 1.050 485 1.000 Inparanoid score I1431
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D285390at33208
OrthoFinder 1 1.000 FOG0001140
OrthoInspector 1 1.000 T1072444
orthoMCL 1 0.900 OOG5_126735
Panther 1 1.100 LDO PTHR10615
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R415
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1312.790

Return to query results.
Submit another query.