DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and HAM1

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_201266.1 Gene:HAM1 AraportID:AT5G64610 Length:445 Species:Arabidopsis thaliana

Alignment Length:504 Identity:201/505 (40%)
Similarity:275/505 (54%) Gaps:77/505 (15%)


  Fly   316 QTVLSANVEAISDDSSETSSSDDDEEEEEDEDDALTMEHDNTSRE-----TVITTGDPLMQKIDI 375
            :|.:.....|.:.::..|:..|.::........|||....:.|::     ..:..|..:|     
plant     8 ETAMIIATPASNHNNPATNGGDANQNHTSGAILALTNSESDASKKRRMGVLPLEVGTRVM----- 67

  Fly   376 SENPDKIYFIRREDGTVHRGQVLQSRTTENAAAPD-EYYVHYVGLNRRLDGWVGRHRISDNADDL 439
                     .:..||..|..:|::.|...|....| ||||||...|||||.|:            
plant    68 ---------CQWRDGKYHPVKVIERRKNYNGGHNDYEYYVHYTEFNRRLDEWI------------ 111

  Fly   440 GGITVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRKMTR 504
                              ..|.|...:...|.......|                  .:..||||
plant   112 ------------------KLEQLDLDSVECALDEKVEDK------------------VTSLKMTR 140

  Fly   505 YQKRRYDEINHVQKSHAELTATQAALEKEHESITKIKYIDKLQFGNYEIDTWYFSPFPEEYGKAR 569
            :|||:.|| .||: .|.||   .||..:|||..||:|.|..::.|.|||:||||||||.||....
plant   141 HQKRKIDE-THVE-GHEEL---DAASLREHEEFTKVKNIATIELGKYEIETWYFSPFPPEYNDCV 200

  Fly   570 TLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLF 634
            .|:.||:||.:|:.:.....|:.:||.:.|||.||||...:|::||:||:..:|.|.||.:||||
plant   201 KLFFCEFCLSFMKRKEQLQRHMRKCDLKHPPGDEIYRSSTLSMFEVDGKKNKVYAQNLCYLAKLF 265

  Fly   635 LDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAF 699
            ||||.||:|:|.||||||||.|..|.|:||||||||.|.|.||:||||.|||:||||:||.||||
plant   266 LDHKTLYYDVDLFLFYILCECDDRGCHMVGYFSKEKHSEEAYNLACILTLPPYQRKGYGKFLIAF 330

  Fly   700 SYELSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIY 764
            |||||:|||.:|:||:||||||.:|||.||...||:::|..  ...|:|||||:|:.|..:||:.
plant   331 SYELSKKEGKVGTPERPLSDLGLVSYRGYWTRILLDILKKH--KGNISIKELSDMTAIKAEDILS 393

  Fly   765 TLQSMKMIKYWKGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSP 813
            ||||:::|:|.|||:|||...|.:..||:..  .:..|.:|...::|:|
plant   394 TLQSLELIQYRKGQHVICADPKVLDRHLKAA--GRGGLDVDVSKMIWTP 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 19/51 (37%)
NAT_SF 528..813 CDD:302625 153/285 (54%)
MOZ_SAS 599..778 CDD:280097 111/179 (62%)
HAM1NP_201266.1 PLN00104 1..445 CDD:215056 201/505 (40%)
Tudor-knot 60..118 CDD:288553 23/102 (23%)
NAT_SF 157..440 CDD:302625 154/290 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41676
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D629545at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126735
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.704 Consistency score
54.820

Return to query results.
Submit another query.