DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and HAM2

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_196536.1 Gene:HAM2 AraportID:AT5G09740 Length:445 Species:Arabidopsis thaliana

Alignment Length:565 Identity:215/566 (38%)
Similarity:284/566 (50%) Gaps:139/566 (25%)


  Fly   250 PPPAAEQVPETPASPTDDGEEPPAVYLSPYIRSRYMQESTPGLPTRLAPRDPRQRNMPPPAVVLP 314
            |||::.|.|  ||:...||..||                                  |||  :.|
plant    14 PPPSSNQKP--PATNGVDGSHPP----------------------------------PPP--LTP 40

  Fly   315 IQTVLSANVEAISDDSSETSSSDDDEEEEEDEDDALTMEHDNTSRETVITTGDPLMQKIDISENP 379
            .|.::.      ||.|.:....            .|.:|           .|..:|         
plant    41 DQAIIE------SDPSKKRKMG------------MLPLE-----------VGTRVM--------- 67

  Fly   380 DKIYFIRREDGTVHRGQVLQSRTTENAAAPD-EYYVHYVGLNRRLDGWVGRHRISDNADDLGGIT 443
                 .|..||..|..:|::.|...|....| ||||||...|||||.|                 
plant    68 -----CRWRDGKHHPVKVIERRRIHNGGQNDYEYYVHYTEFNRRLDEW----------------- 110

  Fly   444 VLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRKMTRYQKR 508
                         |..:.|...:...|.......|                  .:..||||:|||
plant   111 -------------TQLDQLDLDSVECAVDEKVEDK------------------VTSLKMTRHQKR 144

  Fly   509 RYDEINHVQKSHAELTATQAALEKEHESITKIKYIDKLQFGNYEIDTWYFSPFPEEYGKARTLYV 573
            :.|| .|:: .|.||   .||..:|||..||:|.|..::.|.|||:||||||||.||.....|:.
plant   145 KIDE-THIE-GHEEL---DAASLREHEEFTKVKNISTIELGKYEIETWYFSPFPPEYNDCVKLFF 204

  Fly   574 CEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHK 638
            ||:||.:|:.:.....|:.:||.:.|||.||||.|.:|::||:||:..:|.|.||.:||||||||
plant   205 CEFCLNFMKRKEQLQRHMRKCDLKHPPGDEIYRSGTLSMFEVDGKKNKVYAQNLCYLAKLFLDHK 269

  Fly   639 VLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYEL 703
            .||:|:|.||||:|||.|..|.|:||||||||.|.|.||:||||.||.:||||:||.||||||||
plant   270 TLYYDVDLFLFYVLCECDDRGCHMVGYFSKEKHSEEAYNLACILTLPSYQRKGYGKFLIAFSYEL 334

  Fly   704 SRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQS 768
            |:|||.:|:||:||||||.||||.||...|||::|..  ...|:|||||:::.|..:||:.||||
plant   335 SKKEGKVGTPERPLSDLGLLSYRGYWTRVLLEILKKH--KGNISIKELSDVTAIKAEDILSTLQS 397

  Fly   769 MKMIKYWKGQNVICVTSKTIQDHLQLPQFKQPKLTIDTDYLVWSP 813
            :::|:|.|||:|||...|.:..||:..  .:..|.:|...|:|:|
plant   398 LELIQYRKGQHVICADPKVLDRHLKAA--GRGGLDVDASKLIWTP 440

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 20/51 (39%)
NAT_SF 528..813 CDD:302625 154/285 (54%)
MOZ_SAS 599..778 CDD:280097 111/179 (62%)
HAM2NP_196536.1 PLN00104 1..445 CDD:215056 215/566 (38%)
Tudor-knot 60..118 CDD:288553 25/113 (22%)
NAT_SF 157..422 CDD:302625 151/270 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 1 1.000
Homologene 1 1.000 H41676
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D629545at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126735
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.815 Consistency score
54.820

Return to query results.
Submit another query.