DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and Kat5

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001349301.1 Gene:Kat5 MGIID:1932051 Length:546 Species:Mus musculus

Alignment Length:552 Identity:195/553 (35%)
Similarity:271/553 (49%) Gaps:149/553 (27%)


  Fly   386 RREDGTVHR----------------GQVLQS-------RTTENAAAPDE---------------- 411
            |||.|.|.|                |::::.       |..:|   .||                
Mouse    13 RREPGEVGRARGPPVADPGAALSPQGEIIEGCRLPVLRRNQDN---EDEWPLAEILSVKDISGRK 74

  Fly   412 -YYVHYVGLNRRLDGWVGRHRI-------------SDNADDLGG--------------------- 441
             :||||:..|:|||.||...|:             :...:.|.|                     
Mouse    75 LFYVHYIDFNKRLDEWVTHERLDLKKIQFPKKEAKTPTKNGLPGSRPGSPEREVPASAQASGKTL 139

  Fly   442 -----ITV---LP-----APPLAPDQPSTSREMLAQQ---------------------------- 465
                 ||:   ||     .|...||||.:|...|...                            
Mouse   140 PIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHRSTKRKVEVVSPATPVPSETAPASVFP 204

  Fly   466 ---AAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRKMTRYQKRRYDEINHVQKSHAELTATQ 527
               :|..|.|:...:||.:|       |..:..|..|..         |.|....:....|.:  
Mouse   205 QNGSARRAVAAQPGRKRKSN-------CLGTDEDSQDSS---------DGIPSAPRMTGSLVS-- 251

  Fly   528 AALEKEHESI-TKIKYIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHL 591
               ::.|:.| |::|.|:.::.|.:.:..|||||:|:|......||:||:||||.|.......||
Mouse   252 ---DRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTTLPVLYLCEFCLKYGRSLKCLQRHL 313

  Fly   592 HECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETD 656
            .:||.|.|||.||||||.||.:|::|::...|.|.|||:||.|||||.||:|.||||||::.|.|
Mouse   314 TKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYVMTEYD 378

  Fly   657 KEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLG 721
            .:|.||||||||||:|.|:|||||||.|||:||:|:|||||.||||||:.||..|:|||||||||
Mouse   379 CKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLG 443

  Fly   722 RLSYRSYWAYTLLEL---MKTRCAPE-QITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQNVIC 782
            .|||||||:.|:||:   :|:..... ||||.|:||::.|..:|:|.|||.:.:|.|:|||.::.
Mouse   444 LLSYRSYWSQTILEILMGLKSESGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILT 508

  Fly   783 VTSKTIQDHLQLPQFKQPKLTIDTDYLVWSPQ 814
            ::...:..| :....|: .|.||:..|.::|:
Mouse   509 LSEDIVDGH-ERAMLKR-LLRIDSKCLHFTPK 538

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 22/86 (26%)
NAT_SF 528..813 CDD:302625 147/290 (51%)
MOZ_SAS 599..778 CDD:280097 113/183 (62%)
Kat5NP_001349301.1 Tudor-knot 40..98 CDD:338075 15/61 (25%)
PLN00104 76..537 CDD:215056 183/484 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D285390at33208
OrthoFinder 1 1.000 FOG0001140
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126735
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R415
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.