DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and kat5

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001072274.1 Gene:kat5 XenbaseID:XB-GENE-5820892 Length:506 Species:Xenopus tropicalis

Alignment Length:485 Identity:183/486 (38%)
Similarity:256/486 (53%) Gaps:110/486 (23%)


  Fly   412 YYVHYVGLNRRLDGWVGRHRISDNADDL------------------------------------- 439
            :||||:..|:|||.||...|:     ||                                     
 Frog    42 FYVHYIDFNKRLDEWVTHDRL-----DLKKIQFPKKEAKTPTKNGLPGSRPSSPEREVRKIPELI 101

  Fly   440 ---------GGIT----------VLPAPPLAPDQPSTSREMLAQQAAA----------------- 468
                     ||.:          |.||.|:.|...:|...:..|||..                 
 Frog   102 PPPVVPPAAGGKSLPVPKRKVDIVSPATPVPPPPETTQVTVFPQQAPCDVAGVSAHTVMLSQNGA 166

  Fly   469 ----AAAASSERQKRAANKDYYLSYCENSRYDYSDRKMTRYQKRRYDEINHVQKSHAELTATQAA 529
                :|.|....:||.:|       |.::..|..|..         |.|....:....|.:    
 Frog   167 VRRPSAPAVQPGRKRKSN-------CLSADEDSQDSS---------DGIPSAPRMTGSLVS---- 211

  Fly   530 LEKEHES-ITKIKYIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHE 593
             ::.|:. ||::|.|:.::.|.:.:..|||||:|:|......||:||:||||::.......||.:
 Frog   212 -DRSHDDIITRMKNIECIELGRHRLKPWYFSPYPQELTVLPVLYLCEFCLKYVKSLKCLQRHLTK 275

  Fly   594 CDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKE 658
            |:.|.|||.||||||.||.:|::|::...|.|.|||:||.|||||.||:|.|||||||:.|.|.:
 Frog   276 CNLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLDHKTLYYDTDPFLFYIMTEYDCK 340

  Fly   659 GSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRL 723
            |.||||||||||:|.|:|||||||.|||:||:|:|||||.||||||:.||..|:|||||||||.|
 Frog   341 GFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLLIEFSYELSKVEGKTGTPEKPLSDLGLL 405

  Fly   724 SYRSYWAYTLLEL---MKTRCAPE-QITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQNVICVT 784
            ||||||:.|:||:   :||..... ||||.|:||::.|..:|:|.|||.:.:|.|:|||.::.::
 Frog   406 SYRSYWSQTILEILMELKTETGERPQITINEISEITSIKKEDVISTLQYLNLINYYKGQYILTLS 470

  Fly   785 SKTIQDHLQLPQFKQPKLTIDTDYLVWSPQ 814
            ...::.|.:..|  :..|.||:..|.::|:
 Frog   471 EDIVEGHEKAMQ--KRVLRIDSKCLHFTPK 498

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 11/20 (55%)
NAT_SF 528..813 CDD:302625 147/290 (51%)
MOZ_SAS 599..778 CDD:280097 115/183 (63%)
kat5NP_001072274.1 Tudor-knot 6..64 CDD:288553 12/27 (44%)
NAT_SF 212..500 CDD:302625 148/290 (51%)
MOZ_SAS 281..464 CDD:280097 115/183 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D285390at33208
OrthoFinder 1 1.000 FOG0001140
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.