DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and Kat6b

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:XP_006519326.1 Gene:Kat6b MGIID:1858746 Length:2054 Species:Mus musculus

Alignment Length:704 Identity:206/705 (29%)
Similarity:311/705 (44%) Gaps:129/705 (18%)


  Fly   181 TEDEPSSDTVICVADINPYGSGSNIDDFVMDPDAPPNAIITEVVTIPAPLHLKGTQQLGLPLAAP 245
            |.||.|.....        |.||           |.....|:|.|.|:..|....:.....||..
Mouse   358 TSDEGSMSAFT--------GRGS-----------PGRGQKTKVSTTPSSGHAASGKHSSSRLAVT 403

  Fly   246 PPPPPPPAAEQVPETP-----------------------ASPTDDGEEP--PAVYLSPYIRSRYM 285
            .|..|....:....:.                       .:|:.||...  ..:..|.:.|.|..
Mouse   404 DPTRPGATTKTTTSSTYISASTLKVNKKTKGLIDGLTKFFTPSPDGRRSRGEIIDFSKHYRPRKK 468

  Fly   286 QESTPGLPTRLAPRDPRQRNMPPPAVVLPIQTV--LSANVEAISDDSSETSSSDDDEEEEEDEDD 348
            ........:.:......|:..|.|:.:||...:  .|.:.:..|..:|.||:.....:..|....
Mouse   469 VSQKQSCTSHVLATGTTQKLKPAPSALLPPAPISGQSPSSQKSSSSTSSTSTQSSSSQSGEPSFS 533

  Fly   349 ALT-----------MEHDNTSRETVITTGDP-------LMQKIDISENPD-KIYFIRRED----- 389
            :||           :.|..|::......|.|       :.:|.:.|.... |..|..:.|     
Mouse   534 SLTNNSQLKALFDGLSHIYTTQGQSRKKGHPSYAPPKRMRRKTEFSSTAKAKARFFGKRDFRSRL 598

  Fly   390 -------GTVHRGQVLQS-----RTTENAAAPDEYYVHYVGLNRRLDGWVGRHRISDNADDLGGI 442
                   ..:.||.:.::     |||                      ::.:||:      ||.:
Mouse   599 LSHSSCSWGMTRGHIFKAIAHFKRTT----------------------FLKKHRM------LGRL 635

  Fly   443 TVLPAPPLAPDQPSTSREMLAQQAAAAAAASSERQKRAANKDYYLSYCENSRYDYSDRKMTRYQK 507
            .....|.:.  .||:.:..||.     ...:.::..   :.|..:|..:.|    :|..:...::
Mouse   636 KYKVTPQMG--TPSSGKGSLAD-----GRINPDQDN---DTDIKISIKQES----ADVSLVGNKE 686

  Fly   508 RRYDEINHVQKSHAELTATQAALEKEHESITKIKYIDKLQFGNYEIDTWYFSPFPEEYGKARTLY 572
            ...:|...|.|...||:..:...|...|...  :|...::||.|||.|||.||:|:||.:...||
Mouse   687 LVTEEDLDVFKQAQELSWEKIECESGVEDCG--RYPSVIEFGKYEIQTWYSSPYPQEYARLPKLY 749

  Fly   573 VCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDH 637
            :||:|||||:.::....|..:|....||..||||:.::|::||:|....:|||.|||:|||||||
Mouse   750 LCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEVDGNMSKIYCQNLCLLAKLFLDH 814

  Fly   638 KVLYFDMDPFLFYILCETDKEGSHIVGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYE 702
            |.||:|::|||||:|.:.|::|.|:||||||||...:.|||:||:::|.|||:|||:.||.|||.
Mouse   815 KTLYYDVEPFLFYVLTKNDEKGCHLVGYFSKEKLCQQKYNVSCIMIMPQHQRQGFGRFLIDFSYL 879

  Fly   703 LSRKEGVIGSPEKPLSDLGRLSYRSYWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQ 767
            |||:||..|||||||||||||||.:||...:||.: .|.....|:||.:|..:|:...||..|||
Mouse   880 LSRREGQAGSPEKPLSDLGRLSYLAYWKSVILEYL-YRHHERHISIKAISRATGMCPHDIATTLQ 943

  Fly   768 SMKMIKYWKGQNVICVTSKTIQDHLQ-LPQFKQPKLTIDTDYLVWSPQTAAAVV 820
            .:.||....|:.||....|.|..|:: |....:|. .:|.:.|.|:|...:..|
Mouse   944 HLHMIDRRDGRFVIIRREKLILGHMEKLKNCSRPN-ELDPESLRWTPMLISNAV 996

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 9/67 (13%)
NAT_SF 528..813 CDD:302625 136/286 (48%)
MOZ_SAS 599..778 CDD:280097 99/179 (55%)
Kat6bXP_006519326.1 H15 94..168 CDD:197772
PHD1_MOZ_MORF 213..270 CDD:277090
PHD2_KAT6A_6B 272..318 CDD:277002
NAT_SF 721..990 CDD:302625 134/271 (49%)
MOZ_SAS 776..953 CDD:280097 98/178 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_COG5027
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D629545at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.