DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and chm

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001260192.1 Gene:chm FlyBaseID:FBgn0028387 Length:811 Species:Drosophila melanogaster

Alignment Length:863 Identity:254/864 (29%)
Similarity:379/864 (44%) Gaps:215/864 (25%)


  Fly    96 SEDSTPASSTSTSSTRSSSSSRYDDVSEAEEAPPEPEPEQPQQQQQEEKKEDGQDQVKSPGPVEL 160
            |.:|..:|::.::|:.:.|||..|..|...|..|........|.|.:::...|..|.:.|.|.  
  Fly     9 SSESGSSSTSGSTSSETGSSSDTDSSSATPEEKPSTNSSAKSQTQTQQQTNSGNAQRRKPVPA-- 71

  Fly   161 EAQEPAQPQKQKEVVDQEIETEDEPSSDTVICVADINPYGSGSNIDDFVMDPDAPP-----NAII 220
                 |...|.|..|        .|||..|     .||..|..:.||...:..|||     .|:.
  Fly    72 -----ASEDKPKPSV--------APSSKKV-----NNPPKSKLSSDDDEYEDSAPPAKKNSRAMG 118

  Fly   221 TEVVTIPAPLHLKGTQQLGLPLAAPPPPPPPPAAEQVPETPA----SPT------------DDGE 269
            :..||..|              ||......|||:...|..||    :||            ::||
  Fly   119 SSTVTAAA--------------AASAARRKPPASVNKPSNPANKPSNPTQRSANNNTNRSLENGE 169

  Fly   270 -EPPAVYLSPYIRSRYMQESTPG--LPTRLAPR-DPRQ-RNMPPPAVVLPIQTVLSAN------- 322
             :.|::..|.......|:....|  :|.::|.. .|:| |...|||.......|:|::       
  Fly   170 GKRPSLSSSSNSTDDSMKIVKNGRKVPLKMASTVRPKQIRGKLPPAKKNGGGPVISSDGSSGSES 234

  Fly   323 -----------VEAISDDSSETSSS-------------------DDDEEEEEDEDD-------AL 350
                       .|:...|||.:.||                   .|.|||.:|:.:       :|
  Fly   235 GSNSGDESSSGSESEGSDSSNSYSSQPVKGGAKGKRSGPTKIQNSDSEEERKDKANPMRKLTRSL 299

  Fly   351 TMEH------DNTSRETVITTGDPLMQKIDISENPDK----------IYFIRREDGTVHRGQV-- 397
            :|..      ..|..|   :.||....||.||::|.|          ...::||...:..|.:  
  Fly   300 SMRRTKQQPKQETDSE---SDGDLEDDKIMISKSPAKKPAPSNLNASKSKVKREPIGISSGVLSS 361

  Fly   398 LQSR-----TTENAAAPDEYYVHYVGLNR--RLDGWVGRHRISD-----------------NADD 438
            ::||     |......|.|      |.:.  .|.|.:.:|.:.:                 |...
  Fly   362 IKSRPVSPITQTEKKCPIE------GCDSSGHLSGNLDKHFLPEACPIYHNMSASECKERANERK 420

  Fly   439 LGG-------ITVLPAP--------PLAPDQPSTSREMLAQQAAAAAAASSERQKRA----ANKD 484
            |..       :.::.||        .|:|:|    ||.||:          .|:.||    ||.:
  Fly   421 LRNEQRLKMPVNIVTAPGNQNTNLKTLSPEQ----REFLAK----------IRESRANFKPANNN 471

  Fly   485 YYLSYCENSRYDYSDRK--------MTRYQKRRYDEINHVQKSHAELTATQAALEKEHESITKIK 541
            :..|..:..: |.:|..        :..|..:.:.|        |:..|:: .:|.|.:.:...|
  Fly   472 FLDSKVKLEK-DVTDEDREPNLAGLVPDYDLQLFRE--------AQAQASE-RIEDELKDLPVGK 526

  Fly   542 YIDKLQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRRRPPGREIYR 606
            .|..:..|.|::..||.||:|::..:...:|:||:||:|.:..:....|..:|..|.|||.||||
  Fly   527 GIKYISMGKYKMKVWYQSPYPDDAARLPKMYICEFCLRYQKSETGIKRHAEKCVWRHPPGDEIYR 591

  Fly   607 KGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHIVGYFSK--- 668
            ||.:.:::|:||....|||.|||:||.|||||.||:|::||||||:...|.:|.||||||||   
  Fly   592 KGKLQVWQVDGKRYKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYIMTLADVDGCHIVGYFSKHIP 656

  Fly   669 ---EKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRSYWA 730
               ||.|.  |||:|||.|||:||||:|:|||.|||.|:|.||.||||||||||||.:||||||.
  Fly   657 FLQEKNSF--YNVSCILTLPPYQRKGYGRLLIDFSYLLTRVEGKIGSPEKPLSDLGLISYRSYWK 719

  Fly   731 YTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQNVICVTSKTIQDHLQLP 795
            ..||:.:..| :...|.||::|:.:.|...||:.|||::.|:|||||::::......:.::.:..
  Fly   720 DVLLDYLCNR-SGNTIAIKDVSQETAIYSYDIVSTLQALGMMKYWKGKHIVLKKQDVLDEYEERV 783

  Fly   796 QFKQPKLTIDTDYLVWSP 813
            :.:.....||...|.|.|
  Fly   784 KRRGTFPKIDDSCLRWQP 801

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 12/59 (20%)
NAT_SF 528..813 CDD:302625 132/291 (45%)
MOZ_SAS 599..778 CDD:280097 108/185 (58%)
chmNP_001260192.1 zf-C2HC 376..402 CDD:279824 6/32 (19%)
NAT_SF 526..802 CDD:302625 131/280 (47%)
MOZ_SAS 584..766 CDD:280097 108/185 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78117893
eggNOG 1 0.900 E1_COG5027
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 227 1.000 Inparanoid score I2186
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D285390at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 1 0.900 OOG5_126735
Panther 1 1.100 P PTHR10615
RoundUp 00.000 Not matched by this tool.
65.890

Return to query results.
Submit another query.