DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: mof and enok

Sequence 1:NP_511051.1 Gene:mof FlyBaseID:FBgn0014340 Length:827 Species:Drosophila melanogaster
Sequence 2:NP_001286823.1 Gene:enok FlyBaseID:FBgn0034975 Length:2291 Species:Drosophila melanogaster

Alignment Length:808 Identity:218/809 (27%)
Similarity:346/809 (43%) Gaps:221/809 (27%)


  Fly   129 PEPEPEQPQQQQQEEKKEDGQDQ----VKSPGPVELEAQEPAQPQKQKEVVDQEIETED--EPSS 187
            |:.:|:.|.:.:...|:  |.|.    .|....:::||:......|......|.|:.:.  |..|
  Fly   279 PDKKPKHPYRCKTCSKQ--GFDTPKLVKKDNSRIKMEAERMTPSYKYASNKRQSIKKDGNIESPS 341

  Fly   188 DTVICVADINPYGSGSNIDDFVMDPDAPPNAIITEVVTIPAPLHLKGTQQLGLPLAAPPPPPPPP 252
            .:.:||     |..|:.                                                
  Fly   342 TSKLCV-----YNDGNG------------------------------------------------ 353

  Fly   253 AAEQVPETPASPTDDGEEPPAVYLSPYIRSRYMQESTPGLPTRLAPRDPRQRNMPPPAVVLPIQT 317
            ...:||.:.:|...:..|....:.|...||:.:|..      .||.::.|:|..           
  Fly   354 QRRKVPASLSSRKMNHSEDQFEFPSKQKRSQILQGG------YLASQETRKRTF----------- 401

  Fly   318 VLSANVEAISDDSSETSSSDDDEEEEEDEDDALTMEHDN-----TSRETVITT---GDPLMQKID 374
                      .|.|.||||.:.|:|::::||......||     ||.::..::   .|......|
  Fly   402 ----------SDLSSTSSSSESEDEDDEDDDRNRNGDDNDQDESTSSDSCTSSSSDSDSSESSSD 456

  Fly   375 ISENPDKIYFIRRED-----GTVHRGQVLQS--------RTTENAAAPDEYYVHYVGLNRRL--D 424
            .||..|:  :...||     .|:....|.:|        .|.:...:|.         |..|  :
  Fly   457 TSEWDDE--YDEEEDYDTDRSTIREKNVFESGKQSCAKLSTGDGLGSPQ---------NNELGSE 510

  Fly   425 GW----VGRHRI-----SDNADDLGGI--------TVLPAP---------PLAPDQPSTSREMLA 463
            .|    |.::.|     |.:..::.||        |...:|         |:|...|..:...:.
  Fly   511 NWGFAAVAKNPIDIFVKSKHNSNVKGIGYSKPAASTFATSPAANRVQKSTPVASSTPEKNSAPIG 575

  Fly   464 QQAAAAAAASSERQK--------RAANKDYYLSYCENSRYDYSDRKMTRYQKRRYDEINHVQKSH 520
            ........|:.:::|        ..|.|.|  ..||:.....::..:.:.|  ..:||...:::|
  Fly   576 GMTIKRQTANGQKKKIVPLKSMPLEAGKSY--EKCEDDIPYLTEETVMKVQ--LLEEIERSRETH 636

  Fly   521 AE--------------------------------LTATQAALEKE--HESITKI--KYIDK---- 545
            ::                                :|||...|.:|  |:::.::  .:|:|    
  Fly   637 SQADGKREMNNDEDAPGESTKRANPFENQPLPPGVTATDVELYQEVLHKAVVQMSNNHIEKVNDV 701

  Fly   546 -------------LQFGNYEIDTWYFSPFPEEYGKARTLYVCEYCLKYMRFRSSYAYHLHECDRR 597
                         :|.|.::|:|||.||||:||.:...|::||:||||.:.||....|.::|..:
  Fly   702 SLKSGQNTQSPKSIQIGKWDIETWYSSPFPQEYARLLKLFLCEFCLKYTKSRSVLDRHQNKCIWK 766

  Fly   598 RPPGREIYRKGNISIYEVNGKEESLYCQLLCLMAKLFLDHKVLYFDMDPFLFYILCETDKEGSHI 662
            :|||.||:|:||||::||:|....:|||.|||:||.|||||.||:|::|||||||.:.|:.|.|:
  Fly   767 QPPGTEIFRQGNISVFEVDGNVNKIYCQNLCLLAKFFLDHKTLYYDVEPFLFYILTKNDQSGCHL 831

  Fly   663 VGYFSKEKKSLENYNVACILVLPPHQRKGFGKLLIAFSYELSRKEGVIGSPEKPLSDLGRLSYRS 727
            ||||||||...:.|||:|||.:|.:||:|:|:.||.|||.|||:||.:|:|||||||||||||.|
  Fly   832 VGYFSKEKHCTQKYNVSCILTMPQYQRQGYGRFLIDFSYLLSREEGQLGTPEKPLSDLGRLSYFS 896

  Fly   728 YWAYTLLELMKTRCAPEQITIKELSEMSGITHDDIIYTLQSMKMIKYWKGQ-------NVICVTS 785
            ||...:||.:.......:||.|:::..:|:...||....:.:..||..|..       ||.....
  Fly   897 YWKSVVLEYLYKHRNYTKITFKDIAIKTGLAISDIALAFELLNFIKLRKNDGDIRYQINVKIEWK 961

  Fly   786 KTIQDHLQLPQFKQPKLTIDTDYLVWSP 813
            |.:..|.::...| .::.|:.|.|.|||
  Fly   962 KVLAHHNKMANSK-TRIIIEPDCLRWSP 988

Known Domains:


GeneSequenceDomainRegion External IDIdentity
mofNP_511051.1 Tudor-knot 382..432 CDD:288553 11/69 (16%)
NAT_SF 528..813 CDD:302625 134/313 (43%)
MOZ_SAS 599..778 CDD:280097 96/179 (54%)
enokNP_001286823.1 H15 95..152 CDD:294056
PHD_SF 183..>215 CDD:304600
PHD 248..292 CDD:214584 3/13 (23%)
NAT_SF 713..989 CDD:302625 130/278 (47%)
MOZ_SAS 768..947 CDD:280097 96/179 (54%)
Ehrlichia_rpt <1150..>1539 CDD:118064
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C78117999
eggNOG 1 0.900 E1_COG5027
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D285390at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10615
RoundUp 00.000 Not matched by this tool.
43.940

Return to query results.
Submit another query.